Independent prototype · not a Government of Telangana system
Live public data
Telangana Agriculture · Public discourse monitoring
Agriculture Intelligence
Updated 17 Sept, 15:56 IST
Stablefertilizer-availability95%

Fertilizer availability

256 distinct public items from 166 independent authors; with district-level evidence in Sangareddy, Rajanna Sircilla, Warangal, Wanaparthy, Vikarabad, Medak, Medchal–Malkajgiri, Peddapalli, Mahabubnagar, Nizamabad, Jogulamba Gadwal, Suryapet, Nagarkurnool, Khammam, Mahabubabad, Siddipet, Jagtial, Adilabad, Nirmal, Mancherial, Hanumakonda, Bhadradri Kothagudem, Jangaon, Jayashankar Bhupalpally, Karimnagar, Kamareddy, Nalgonda, Yadadri Bhuvanagiri, Mulugu, Komaram Bheem Asifabad, Narayanpet; 1 originate from farmer or farmer-organisation voices; 17 official statements recorded.

How the discussion developed

1
15 Jun
1
22 Nov
1
23 Dec
1
29 Dec
1
14 Jul
1
28 Jul
1
22 May
1
28 Jun
1
24 Jan
1
3 Jun
1
5 Jun
1
31 Jul
1
25 Aug
1
4 Sept
2
16 Feb
1
17 Feb
1
22 Mar
1
29 Mar
1
12 Apr
1
26 May
1
28 May
1
7 Jun
1
11 Jun
1
23 Jun
1
20 Jul
2
1 Aug
1
9 Sept
1
2 Dec
1
13 May
1
24 Jun
1
25 Jun
1
22 Jul
1
12 Sept
1
2 Dec
1
11 Dec
1
17 Dec
1
15 Jan
1
17 Jan
1
18 May
1
20 May
1
4 Aug
1
14 Apr
1
25 May
7
27 May
1
28 May
2
30 May
1
15 Jun
1
6 Aug
1
14 Oct
1
21 Oct
1
20 Dec
1
31 Dec
1
24 Jan
1
6 Feb
1
22 Feb
1
25 Feb
1
6 Mar
1
8 Apr
1
13 May
1
23 May
1
26 May
1
27 May
1
1 Jun
1
3 Jun
3
5 Jun
1
6 Jun
1
18 Jun
1
19 Jun
1
20 Jun
2
1 Jul
1
5 Jul
2
16 Jul
1
22 Jul
1
23 Jul
1
24 Jul
1
25 Jul
1
26 Jul
1
28 Jul
1
30 Jul
1
31 Jul
1
5 Aug
1
9 Aug
1
14 Aug
1
17 Aug
2
19 Aug
3
20 Aug
1
21 Aug
2
22 Aug
2
23 Aug
1
25 Aug
1
30 Aug
1
6 Sept
3
8 Sept
1
9 Sept
1
17 Sept
1
18 Sept
1
11 Oct
2
25 Oct
1
25 Nov
1
11 Dec
1
19 Dec
1
20 Dec
1
21 Dec
3
22 Dec
1
29 Dec
2
31 Dec
1
20 Jan
1
30 Jan
1
5 Feb
1
12 Mar
1
25 Mar
2
31 Mar
1
2 Apr
1
9 Apr
1
13 Apr
1
15 Apr
1
20 Apr
6
27 Apr
2
28 Apr
1
5 May
2
7 May
2
13 May
1
15 May
1
17 May
1
18 May
3
22 May
1
25 May
2
27 May
1
2 Jun
1
4 Jun
1
5 Jun
1
6 Jun
1
7 Jun
2
10 Jun
1
11 Jun
1
12 Jun
1
13 Jun
1
14 Jun
2
16 Jun
2
23 Jun
1
24 Jun
2
27 Jun
2
29 Jun
1
30 Jun
1
2 Jul
1
7 Jul
4
10 Jul
3
12 Jul
1
14 Jul
1
16 Jul
3
18 Jul
1
19 Jul
1
23 Jul
1
26 Jul
1
27 Jul
1
28 Jul
1
30 Jul
2
31 Jul
3
1 Aug
3
4 Aug
2
5 Aug
1
11 Aug
2
12 Aug
1
15 Aug
1
16 Aug
2
17 Aug
1
19 Aug
2
21 Aug
4
22 Aug
2
23 Aug
1
24 Aug
3
25 Aug
1
26 Aug
1
27 Aug
5
28 Aug
1
31 Aug
2
3 Sept
2
4 Sept
1
5 Sept
1
6 Sept
3
7 Sept
1
9 Sept
2
12 Sept
3
13 Sept
1
15 Sept
2
16 Sept

Claims inside this narrative

Model-extracted assertions from individual items. Each links to the evidence that contains it; none are verified statements of fact.

  • “A farmer from Balkonda says he is facing problems with electricity supply and fertilizer availability, including not getting fertilizer on time and stock not being available in godowns.”Media organisation86%
  • “The content says tenant farmers in Telangana may be given recognition certificates based on a farmer commission report, which could help them access loans, subsidised fertiliser, seeds, and procurement benefits.”Journalist79%
  • “A pest is damaging banana plants, and the speaker says spraying certain medicines is a way to prevent it.”Creator86%
  • “Under the Kisan Credit Card (KCC), farmers can get loans at 7% interest, and if repaid on time the effective interest rate becomes 4%.”Media organisation93%
  • “Farmers at Kandukur in Vemsoor mandal of Khammam district laid siege to a local electrical substation in protest against power outages.”Media organisation99%
  • “Farmers pleaded with officials at the Ellampet substation in Maripeda Mandal, Mahabubabad district, because electricity supply was irregular and their crops were drying.”Media organisation98%
  • “The Agriculture Minister rules out scrapping the fertiliser booking app.”Media organisation97%
  • “For short- and medium-duration paddy varieties, fertilizers should be applied in three splits, while long-duration varieties require four splits.”Media organisation88%
  • “Farmers protested in front of a fertilizer shop in Mancherial district.”Media organisation98%
  • “Farmers in Medak district are waiting since morning for fertilizers.”Media organisation90%
  • “A program on monsoon-season paddy integrated nutrient management is scheduled from 4:00 PM to 5:00 PM, presented by Dr. K. Chandra Shekhar, Coordinator, Telangana Rythu Vignana Kendram, Suryapet.”Media organisation86%
  • “There is a fertilizer app issue in Rayaparthi, Warangal district.”Media organisation78%
  • “Farmers protested over fertilizer shortage in Medak district.”Media organisation98%
  • “A memorandum regarding agriculture, farmer insurance, and fertilizer problems was submitted to the MRO at the Khila Warangal Tahsildar office.”Politician96%
  • “The video introduces PROMIN Organic Granulated Fertilizer through a conversation between a farmer and an agricultural products dealer.”Dealer90%
  • “Farmers in the newly formed Boraj, Satnala and Sonala mandals of Adilabad district are facing difficulties in accessing fertilizers because the new mandals were not updated on the relevant agricultural app.”Media organisation97%
  • “Potash is an important nutrient for paddy crop growth, stem strength, water use, grain development, and crop health.”Media organisation95%
  • “The 'Fertilizer Sales' policy has been expanded in Telangana to 22 districts, after being piloted in Medchal-Malkajgiri district.”Media organisation95%
  • “The Framework for Fertilizers Sale (FFS) mobile app has been introduced to enable fertilizer purchases based on land area and crops grown.”Media organisation96%
  • “The content says these are the fertilizers for higher yield in tissue-culture banana.”Media organisation83%
  • “In North Telangana, after heavy rain, cotton should be given 50 kg urea + potash, 10 kg zinc, and 1 kg boron in the soil.”Citizen74%
  • “In North Telangana, after heavy rain, for cotton 50 kg urea + potash, 10 kg zinc, and 1 kg boron should be applied to the soil.”Citizen91%
  • “Tummala wrote to the Union Minister about the shutdown of the Ramagundam Fertilizers Plant.”Media organisation96%
  • “Eastern Telangana cotton farmers should apply one bag of urea, potash, 10 kg zinc, and 5 kg borax, and it will rain next week.”Citizen88%
  • “Adilabad police arrested five people in a fake fertilizer franchise cyber fraud case, and a ₹3.5 crore fraud is suspected.”Media organisation99%
  • “In Telangana, 60–70% of agriculture depends on rainfall.”Media organisation88%
  • “The content mentions "the fertilizer day" and includes the hashtag #nalgonda.”Creator89%
  • “Only farmers registered in the Farmer Registry will be able to book fertilizers under the new system.”Media organisation93%
  • “Rythu Bharosa is providing timely financial support to Telangana farmers for seeds, fertilisers, and other essential farming needs.”Politician95%
  • “The text says that Azaz Fertilizers in Mondrai, Warangal is an authorised distributor of Farmova Global's organic fertilizer 'Keromin'.”Dealer93%
  • “A maize farmer from Mahabubnagar achieved excellent crop growth without applying granules or chemical fertilizers, and armyworm was controlled with Mayura.”Farmer90%
  • “DEVI IPM Fertilizers & Seeds in Khammam provides seeds, fertilizers, and agricultural products for crop care.”Dealer94%
  • “Farmers in Parigi constituency of Vikarabad district caught fake DAP fertilizer and handed it over to agriculture department officials.”Media organisation98%
  • “Farmers are angry about fertilizers being given online in Bhadradri Kothagudem District.”Media organisation95%
  • “Fertilizers are being sold through FFS, as stated in the text.”Media organisation78%
  • “Vigilance is focusing on fake fertilizer in Telangana.”Media organisation83%
  • “A fake fertilizer gang was exposed and arrested in Nagarkurnool district.”Media organisation98%
  • “A fake fertilizer group was exposed in Nagarkurnool.”Media organisation97%
  • “There is a fake fertilizer issue in Nagarkurnool district.”Media organisation90%
  • “Fake DAP fertilizers were seized in Tandur.”Media organisation98%
  • “Fake DAP fertilizer bags were identified in Tandur Mandal.”Media organisation95%
  • “Thummala asked for measures to ensure there is no fertilizer shortage.”Media organisation95%
  • “Police in Suryapet district busted a racket that was manufacturing and selling fake DAP fertilizer products to farmers.”Media organisation98%
  • “Agriculture department officials and police jointly inspected a case in Yalala mandal, Vikarabad district, and seized 43 suspicious bags of DAP fertilizer.”Media organisation96%
  • “There is floodwater at a fertilizer factory in Peddapalli.”Media organisation93%
  • “A fake DAP fertilizer racket was busted in Vikarabad.”Media organisation96%
  • “Farmers were cheated after buying fake DAP from middlemen.”Media organisation96%
  • “Farmers in Palamuru are concerned about fake DAP fertilizer sales.”Media organisation95%
  • “A fake DAP fertilizer gang was exposed in Nagarkurnool district.”Media organisation98%
  • “The shop in Shambunipet, Warangal sells fertilizers, pesticides, and seeds wholesale and retail.”Dealer98%
  • “The content is about fake fertilizers.”Media organisation96%
  • “Water-soluble fertilizers used in drip irrigation dissolve completely in water, unlike broadcast fertilizers such as urea and DAP, and drip application can use 20–30% less fertilizer for better results.”Creator93%
  • “20-20-0-13 fertilizer is being applied in cotton for strong root system growth.”Farmer86%
  • “El Nino has affected fertilizer shops in Nalgonda district, leaving them without customer traffic.”Media organisation78%
  • “Markfed has stopped free transportation for PACS in Telangana, and it had already been stopped for DCMS and ARS in the past.”Media organisation95%
  • “An fertilizer shop was burned in Mahabubabad.”Media organisation90%
  • “There are fertilizer difficulties in Doulthabad, Sangareddy district.”Media organisation90%
  • “There is a fertilizers shortage in Sangareddy district.”Media organisation96%
  • “Farmers in Medak are angry due to a fertilizer shortage.”Media organisation95%
  • “Farmers in Medak district are facing fertilizer difficulties.”Media organisation93%
  • “Farmers in Medak district are facing fertilizer difficulties.”Media organisation88%
  • “A farmers' conference in Khammam district had stall number 19 displaying Dhatri fertilizers.”Creator93%
  • “The Agriculture and Police departments jointly conducted surprise inspections of seed and fertilizer shops in Sircilla Mandal, Rajanna Sircilla district.”Media organisation97%
  • “There is no fertilizer shortage in Rajanna Sircilla district and sufficient fertilizers are available for crop cultivation.”Media organisation98%
  • “The content says manure delivery is available to the Wargal, Mulugu, and Siddipet areas.”Dealer98%
  • “Farmers are protesting in Sircilla over a fertilizer issue.”Media organisation88%
  • “KISAAN AGRI MALL is in Mahabubabad and deals with fertilizers/pesticides.”Dealer90%
  • “Nagarkurnool farmers are facing fertilizer shortage and rain-related problems under the Congress government and Revanth rule.”Media organisation91%
  • “The Central Government has ensured an adequate supply of fertilizers for farmers in Telangana ahead of the Kharif season.”Media organisation92%
  • “Sudden inspections were conducted at fertilizer shops in Mulugu.”Media organisation98%
  • “Telangana Government has decided to introduce a new Mandal-Level Unit system in the fertilizer booking app.”Media organisation95%
  • “The content refers to fertilizer being delivered to homes in Nizamabad.”Media organisation72%
  • “Sri Ramkrishna Seeds, Fertilizer and Pesticides is in Mahabubabad.”Unclassified96%
  • “Vikarabad district collector Deepak Tiwari said that fertilizer dealers' licenses will be issued.”Media organisation92%
  • “There is a fertilizer shortage in Nizamabad district.”Media organisation96%
  • “A fertilizer goods wagon train reached Nizamabad city.”Media organisation97%
  • “Rythu Commission Member Gangadhar inspects fertilizer shops in Nizamabad.”Media organisation98%
  • “A dharna was held in Nirmal district under the leadership of AiKMS demanding free fertilizers and seeds for farmers.”Citizen97%
  • “An awareness programme under #KhetBachaoAbhiyan was conducted in Gadwal District, Telangana.”Media organisation97%
  • “Collector Tripathi inspected single-window and fertilizer shops in Edapalli, Nizamabad.”Media organisation98%
  • “There is a fertilizer shortage in Nizamabad at the start of the kharif season.”Media organisation96%
  • “Farmers across Mahabubnagar district are preparing their fields for Kharif cultivation ahead of expected rainfall in the next few days.”Media organisation92%
  • “Farmer Mahesh from Nalgonda district has experience using nano fertilizers in his paddy crop.”Media organisation94%
  • “The Ramagundam Fertilizer Plant produced 107,883 metric tons of fertilizer in May and supplied 64,229.15 metric tons to Telangana that month.”Media organisation96%
  • “Measures are being taken to avoid a shortage of fertilizers.”Media organisation94%
  • “Harish Rao inspected rain-soaked grain at Chinnakodur Market Yard in Siddipet, and the transcript says farmers are facing delays, grading issues, and deductions in paddy procurement.”Media organisation91%
  • “The content mentions that fertilizers are prepared for the monsoon season.”Media organisation74%
  • “Jayant Police in Adilabad busted a fake fertilizer racket and seized 60 sacks.”Media organisation99%
  • “A fake fertilizer gang was exposed in Jainath mandal, Adilabad.”Media organisation97%
  • “The program includes a discussion on fertilizer management based on soil testing with scientist M. Suresh from Adilabad KVK.”Media organisation91%
  • “There is a fertilizer shortage in Nizamabad district.”Media organisation97%
  • “The content says a drone can plant sesame seeds and spread fertilizers in 30 minutes in an acre in Adilabad.”Media organisation93%
  • “Professor Ella Goud advises farmers in Peddapalli District to reduce chemical fertilizers.”Media organisation94%
  • “A paddy farmer from Eezeepur village in Kosgi mandal, Narayanpet district says he has been using Nano Urea and Nano DAP on his crop since last year and that it reduced weeds and helped increase yield and profits.”Media organisation95%
  • “Contract workers protested in front of the Ramagundam Fertilizer Factory in Peddapalli District over local jobs.”Media organisation98%
  • “Fertilizer dealers in Nalgonda district are protesting over a reduction in fertilizer supply.”Media organisation98%
  • “The fertilizer shop bandh in Hanamkonda was successful.”Media organisation90%
  • “Fertilizer shops in Adilabad are closed on strike.”Media organisation97%
  • “Fertilizer shop dealers are protesting to demand implementation of the FPL policy for fertilizer supply.”Media organisation95%
  • “Fertilizer shops across the erstwhile Adilabad district are shut.”Media organisation93%
  • “Fertilizer shops are closed across the state.”Media organisation88%
  • “Fertilizer shops are shut in Nizamabad.”Media organisation98%
  • “The government is not able to provide even a fertilizer bag.”Media organisation94%
  • “A testimonial video was collected about using Nano Urea Plus and Nano DAP by a farmer named A. Srinivas from Wadyat village, Morthad mandal, Nizamabad district.”Dealer92%
  • “A farmer from Nizamabad district has experience using IFFCO nano fertilizers in various crops.”Dealer92%
  • “Farmers are taking to the roads over a fertilizer shortage in Nizamabad district.”Media organisation98%
  • “Teja Traders offers fertilizer shop services in Peddapalli and can be contacted at 9866507435.”Dealer92%
  • “Nalgonda District Collector B. Chandrasekhar attended a technical demonstration event at Duppalapally Rytu Vedika in Tipparti mandal and instructed officials to promote nano fertilizers and sustainable agriculture.”Media organisation95%
  • “Farmers complained to the collector about fertilizer shops.”Media organisation92%
  • “The fertilizer factory in Ramagundam is shut down.”Media organisation95%
  • “Farmers are facing difficulties because they cannot get fertilizers.”Media organisation92%
  • “The content mentions Sri Siva Shankar Enterprises & Drip and includes the hashtags #jangaon, #fertilizer, and #pesticides.”Dealer88%
  • “Farmers say they need Rythu Bharosa money to buy fertilizers.”Media organisation86%
  • “Fake fertilizers are being sold in Rajanna Sircilla district.”Media organisation97%
  • “Farmers in Adilabad expressed happiness about the fertilizer booking mobile app.”Media organisation92%
  • “Farmers in Endrial village of Tadwai mandal in Kamareddy district are facing renewed difficulties in obtaining fertilizers.”Media organisation96%
  • “The content mentions Telangana fertilizer application registration.”Creator90%
  • “KCR criticized the mandatory app system for fertilizer distribution and questioned why farmers need an app to buy fertilizer bags.”Media organisation96%
  • “Farmers are facing difficulties due to insufficient fertilizers.”Media organisation95%
  • “Telangana government conducted awareness programs about its Fertilizer App to help farmers book fertilizers through mobile phones.”Media organisation92%
  • “The content mentions a fertilizer booking app.”Farmer94%
  • “An awareness meeting on the fertilizer booking app was held for farmers in Rajanna Sircilla district.”Media organisation98%
  • “The first Muneera Agrotech branch is in Karimnagar.”Media organisation97%
  • “The content says Gangadevipally uses human feces as organic fertilizer.”Media organisation92%
  • “Farmers queue for a year at a fertilizer center in Warangal.”Media organisation93%
  • “A Kamareddy farmer is requesting Chief Minister Revanth Reddy to give a bonus and reduce fertilizer prices.”Media organisation96%
  • “Fertilizers are being applied to saplings at SRR Government Arts and Science College (A) in Karimnagar.”Creator96%
  • “A task force police officer attacked a worker in a fertilizer shop in Gajwel.”Media organisation88%
  • “Mrugashira Fertilizers & pesticides is in Mahabubabad.”Dealer93%
  • “Women farmers are queuing at a fertilizer center due to a shortage in Bhadradri Kothagudem.”Media organisation96%
  • “There is a shortage of fertilizers.”Media organisation98%
  • “There is a fertilizer shortage, and a protest/blockade was held on a national highway under the Congress party's leadership.”Media organisation83%
  • “The content says there is a real shortage of fertilizers and mentions Minister Ponnam Prabhakar's clarification.”Media organisation74%
  • “There is a fertilizer shortage.”Media organisation92%
  • “Farmers protested in front of a Man Gromore fertilizer shop in Mahabubabad mandal because it was not opened.”Media organisation96%
  • “Fertilizer crisis hits farmers in Warangal District.”Media organisation96%
  • “Farmers protested at the collectorate in Nagarkurnool district alleging that substandard fertilizers are being distributed.”Media organisation96%
  • “Women in Mulugu questioned Minister Seethakka about fertilizers and Indiramma houses.”Media organisation92%
  • “BRS leaders staged a dharna at a fertilizer center in Medak.”Media organisation95%
  • “Minister Ponnam told the BJP to provide fertilizers or apologize.”Media organisation78%
  • “Minister Ponnam Prabhakar said that fertilizers will be provided to everyone.”Media organisation83%
  • “Farmers are struggling to get fertilizers in Nalgonda.”Media organisation88%
  • “The post mentions Coromandel fertilizer and Gromo 20:20:0;13 at a fertilizer shop in Makkarajpet, Chegunta, Medak.”Dealer93%
  • “All varieties of fertilizer are available.”Dealer95%
  • “District Collector Rahul Raj said that measures are being taken to ensure there is no fertilizer shortage in Medak district.”Media organisation98%
  • “There is a fertilizer crisis in Mahabubabad district.”Media organisation96%
  • “BRS workers staged a dharna on the Karimnagar highway road demanding timely fertilizer supply to farmers.”Media organisation98%
  • “The MLA and Collector inaugurated a fertilizer shop run by the Shiva Ram Gram Mahila Samakhya Sangham in Bollaram village, Vemulawada Rural mandal, Rajanna Sircilla district.”Media organisation98%
  • “A women’s group fertilizer and seeds shop was started.”Media organisation98%
  • “Farmers in Rajanna Sircilla district are facing difficulties in getting fertilizers.”Media organisation98%
  • “Organic fertilizer manufacturing is being done in Mahabubnagar district in an innovative way.”Media organisation95%
  • “The collector conducted a surprise inspection of the cooperative society fertilizer godown in Mopal and checked whether fertilizer stocks and e-pass handling matched records.”Media organisation98%
  • “The district collector inspected fertilizer shops in Station Ghanpur, Jangaon district.”Media organisation99%
  • “The central government has treated Telangana unfairly in fertilizer distribution.”Media organisation86%
  • “The collector inspected fertilizer godowns in Nizamabad district.”Media organisation98%
  • “Collector Abhilasha Abhinav inspected fertilizer shops in Nirmal.”Media organisation99%
  • “Police inspected fertilizer shops in Jannaram in Adilabad.”Media organisation93%
  • “The collector inspected fertilizer shops in Nirmal district and checked labels, expiry dates, and registers for seeds, fertilizers, and pesticides.”Media organisation95%
  • “Farmers are waiting for fertilizers.”Media organisation90%
  • “A robbery occurred at Shri Sai Fertilizers shop in Adilabad.”Media organisation95%
  • “Farmers are standing in a queue for fertilizers in Hanumakonda.”Media organisation97%
  • “The district farmers will face an additional burden of Rs 8.87 crore due to the increase in potash prices.”Media organisation97%
  • “Agricultural scientists advised farmers not to use chemical fertilizers in excess.”Media organisation96%
  • “Jagtial District Agriculture Officer Bhaskar advised farmers to use only the required amount of fertilizers.”Media organisation96%
  • “The content mentions organic fertilizers and some types of crops.”Creator74%
  • “The Sangareddy Collector inspected a fertilizer shop in NizamPet Mandal.”Media organisation98%
  • “District agriculture officials in Peddapalli district inspected several fertilizer shops and said strict action would be taken against those selling fake fertilizers or fake seeds.”Media organisation94%
  • “Mulugu district collector Diwakar TS conducted a surprise inspection of fertilizer shops.”Media organisation99%
  • “The district collector conducted a surprise inspection of fertilizer and seed shops in Vemulawada town.”Media organisation97%
  • “The collector conducted a surprise inspection of fertilizer and seed shops in Vemulawada.”Media organisation98%
  • “Collector Sandeep Kumar Jha conducted a surprise inspection of several seed and fertilizer sales shops in Vemulawada.”Media organisation98%
  • “Fertilizers and seeds are available at the Narayanpur Rythu Vedika in Vikarabad Mandal for those who want to buy them.”Media organisation98%
  • “Agricultural scientist Srinivas Reddy said that using synthetic chemical fertilizers for high crop yields carries a risk of cancer.”Media organisation78%
  • “Farmers in Sangareddy are waiting for seeds and fertilizers.”Media organisation92%
  • “Jagtial district collector Satya Prasad held a meeting with seed and fertilizer dealers.”Media organisation99%
  • “Jangaon Collector Rizwan Basha suddenly inspected fertilizer shops in Palakurthy.”Media organisation98%
  • “The content warns viewers to take precautions so they are not cheated when buying fake seeds and fertilizers.”Media organisation93%
  • “Ramagundam Fertilizer Factory sets a record.”Media organisation83%
  • “Farmers protested in Yadadri Bhuvanagiri District, Telangana.”Media organisation98%
  • “The central government supplied more fertilizer to Telangana than was required.”Politician94%
  • “Farmers are not receiving fertilizers.”Media organisation94%
  • “Farmers protested in Shayampet, Hanumakonda district, after a weedicide used on maize fields allegedly caused the maize crop to dry up completely.”Media organisation95%
  • “Srilatha Fertilizers is opposite the municipal office in Vemulawada, Sircilla district.”Creator97%
  • “Paddy seeds treated with IFFCO Nano DAP show superior growth compared with untreated seed.”Government90%
  • “The post provides a mobile number for all kinds of seeds and fertilizers.”Dealer90%
  • “Farmers are standing in line for fertilizer in Nirmal district.”Media organisation98%
  • “The content mentions fertilizer and Mahabubnagar.”Creator91%
  • “Fertilizers are being distributed to farmers.”Media organisation87%
  • “Minister Seethakka inaugurated a primary agricultural cooperative society fertilizer warehouse in Incherla village, Mulugu.”Media organisation98%
  • “The content says that in Sangareddy, farmers' required fertilizers and seeds should be made available during the kharif season, and Rythu Bharosa funds should be released in June.”Media organisation92%
  • “The district collector conducted surprise inspections at fertilizer and seed shops in the district headquarters and warned that cases would be filed if prices were charged above MRP.”Media organisation96%
  • “Farmers are queuing for seeds and fertilizers from 4 am at Gandhi Ganji, Kamareddy.”Media organisation99%
  • “There is a fertilizer shortage in Kamareddy and farmers are expressing distress.”Media organisation98%
  • “Farmers lined up for seeds at Jagtial.”Media organisation98%
  • “Farmers lined up in queues for fertilisers in Kamareddy.”Media organisation98%
  • “Farmers are angry because they are not receiving enough fertilizers.”Media organisation95%
  • “Farmers in Kamareddy took to the road demanding fertilizers.”Media organisation96%
  • “Farmers in Kamareddy district lined up for fertilizers.”Media organisation98%
  • “Farmers are standing in queues for fertilizers in Kamareddy.”Media organisation93%
  • “Farmers in Kamareddy district are lining up from 5 a.m. for fertilizers, and only 30 kg of jilegu seeds are being given per passbook.”Media organisation94%
  • “Fake seeds and fertilizers are not being controlled, and farmers are suffering severe losses.”Media organisation93%
  • “Farmers must bring Aadhaar cards to purchase fertilizers.”Media organisation99%
  • “Fertilizer shops were inspected in Bhainsa town, Nirmal district.”Media organisation98%
  • “Wanaparthy district DSP Anand Reddy warned fertilizer shop owners.”Media organisation97%
  • “Farmers are waiting in Kubeer, Nirmal district, for fertilizer bags.”Media organisation99%
  • “Using phosphate solubilizing bacteria can help achieve abundant crop yields.”Media organisation78%
  • “500 kilograms of compost fertilizer made from wet waste was distributed free of cost to residents of Khammam 23rd division.”Media organisation95%
  • “Sai Hanman fertilizer shop is in Rajarampally, Endapelli, Jagtial, Telangana.”Creator95%
  • “A fertilizer made from human manure is being distributed free of cost near Danavaigudem, Khammam Rural mandal.”Creator94%
  • “The content is about organic fertilizers.”Media organisation93%
  • “There is a stir over fake fertilizers in Yadadri Bhuvanagiri district.”Media organisation86%
  • “If fake seeds and fertilizers are sold, action will be taken.”Media organisation95%
  • “A farmer is applying fertilizers while irrigating a cotton crop in Thoongunta village, Aiza mandal, Jogulamba Gadwal district.”Creator98%
  • “An inspection was conducted at Manikanta Traders in Malkapur and no fake seeds or fake fertilizers were found.”Media organisation96%
  • “The Yadadri Bhuvanagiri district additional collector conducted a training program for seed, fertilizer, and pesticide shop dealers at the Rythu Vedika cluster in Muthireddygudem village, Bhongir mandal.”Media organisation98%
  • “Agriculture department officials caught agents selling fake fertilizers and medicines in Konijerla mandal of Khammam district.”Media organisation97%
  • “KK Birla Group fertilizers have reached Karimnagar.”Media organisation93%
  • “KK Birla Group fertilizers have reached Karimnagar.”Media organisation94%
  • “The content refers to fertilizer production in a field.”Media organisation62%
  • “MLA Gandra Venkata Ramana Reddy inaugurated a fertilizer center in Laxmareddypally village, Jayashankar Bhupalpally.”Media organisation99%
  • “Karimnagar Agriculture officer says there is no shortage of seeds and fertilizers.”Media organisation93%
  • “Seeds and fertilizers should be made available.”Media organisation86%
  • “MP Maloth Kavitha participated in an event about grain procurement, seed distribution, and fertilizer distribution in Mahabubabad Parliament constituency.”Media organisation91%
  • “Farmers are angry because the government failed to distribute fertilizers.”Media organisation97%
  • “Fertilizer stock is available at old rates at Mahalaxmi Fertilizer Jangaon / ARSK / ARSK-2 Patelgudem.”Creator86%
  • “FCI fertilizers have arrived in Karimnagar.”Media organisation98%
  • “The content says to use organic fertilizers.”Media organisation86%
  • “A dharna was held under BJP leadership for fertilizer distribution in Jagtial.”Media organisation97%
  • “BJP leaders submitted a request to the Jagityal tahsildar for free fertilizer distribution and loan waiver for farmers.”Media organisation95%
  • “A protest was held in front of the tahsildar office in Jagtial under the district BJP demanding free fertilizers and loan waiver for farmers.”Media organisation96%
  • “Farmers lined up for fertilizers at the Bibipet mandal center in Kamareddy district.”Media organisation97%
  • “Fertilizer store inspections are being conducted in Kamareddy district.”Media organisation97%
  • “The district collector said that fertilizer compost centers should be established in Nagireddipet, Kamareddy.”Media organisation90%
  • “There should be no shortage of seeds and fertilizers for kharif crops in Jagtial district.”Media organisation96%
  • “Police and agriculture officials inspected fertilizer and seed shops in Jagtial district headquarters.”Media organisation99%
  • “A farmer from Jangaon district uses natural and organic fertilizers on his 12 acres and says this helps him obtain better yields and profits.”Media organisation91%
  • “Officials conducted a sudden inspection of seed and fertilizer shops in Mallapur and Mogilipet villages of Jagtial district.”Media organisation97%
  • “Police and agriculture officials inspected fertilizer shops in Jagtial town.”Media organisation98%
  • “A seven-day all-India truckers' strike caused a fertilizer shortage for farmers in Jagtial.”Media organisation93%
  • “An awareness seminar on fake seeds and fertilizer sales was held at the Thorrur division headquarters in Mahabubabad district.”Media organisation97%
  • “Bio fertilizers making started at Municipal Park in Jagtial on 29.12.17.”Media organisation95%
  • “An awareness camp on fertilizers and machines was held for dealers in Jagtial on 23.12.17.”Media organisation95%
  • “Expired fertilizers were seized in Jogulamba Gadwal district.”Citizen96%
  • “Agriculture department officials conducted surprise inspections of fertilizer and seed shops in Jagtial district headquarters and sealed one shop for selling without a license.”Media organisation96%
  • “IFFCO Telangana conducted a crop seminar on the effective use of nano fertilisers for sustainable agriculture with Agriculture Department officials, scientists, and more than 200 farmers.”Government94%
  • “AFM Shri Vishal organised a crop seminar on INM at Anantharam with the Department of Agriculture.”Government92%
  • “GSFC reached 38 farmers at Venkatpur in Warangal district, Telangana, as part of the PM-PRANAM Kisan Sangoshthi.”Government95%
  • “The app allows farmers in Telangana to book fertilizers in six steps, and the video says it will be implemented across all districts in Telangana by the end of August.”Government92%
  • “A Nano Urea field demonstration was conducted under ATMA at Regunta village, Mallapur Mandal, Jagtial District, Telangana.”Government99%
  • “A soil health card distribution program was organized at Atmakur and around 75 farmers participated.”Government92%
  • “A one-day training programme on nano fertilizers for Agriculture Department officials was organized at Jogulamba Gadwal in coordination with ICAR-CRIDA.”Government95%
  • “The Collector urged officials to take modern agricultural technologies closer to farmers and ensure efficient, transparent delivery of services.”Government91%
  • “Smt. Madhavilatha interacted with 10,000 farmers through a Rythu Nestham webinar across 1,600 Rythu Vedikas.”Government94%
  • “FO Shri T. Balvikas participated in the Rythu Nestham program, an online webinar that reached around 10,000 farmers through 1,600 Rythu Vedikas.”Government92%
  • “Officials witnessed the production process and Nano DAP field demonstrations.”Government88%
  • “AFM Shri A Venkatesh organized a Nano fertilizer awareness meeting with ATMA and Agriculture Department officials, and around 68 farmers and 6 AEOs participated.”Government94%
  • “A stall was set up showcasing Nano Urea, Nano DAP, Nano Zinc, Nano Copper, and bio fertilizers, and their importance and uses in agricultural crops were explained to dignitaries and farmers.”Government93%
  • “ICAR-IIOR organized an Intensive Program on Balanced Fertilizer Use at Gopulapur village, Narayanaraopet Mandal, Siddipet District on 18.05.2025.”Government98%
  • “ICAR-IIOR organized an MGMG programme on balanced use of fertilizers at Pedakodur village, Chinnakodur Mandal, Siddipet District on 06 May 2026.”Government98%
  • “ICAR-IIOR organized an MGMG Farmers’ Interaction Programme on balanced fertilizer use at Manchapalle Village, Pudur Mandal, Vikarabad District, Telangana.”Government98%
  • “ICAR-IIOR organized an awareness campaign on the balanced use of fertilizers on 27/04/2026 at Ibrahimpur village, Siddipet district, Telangana.”Government98%

Evidence

256 canonical items · 7 duplicates shown, not counted
YouTubeChanakyyaMedia organisation92%16 Sept, 16:04 IST
Nizamabad · balkonda (86% conf.)Telugustance: critical5 views · 0 likes · 0 comments

Sentiments of Farmers at #nizamabad Telangana

Original — Telugu

One farmer expressed his opinion regarding present Telangana Congress govt.

English · AI translation

My name is Balrajeshwar, sir. It is Balkonda because earlier now our Revanth Reddy government, Congress, is well familiar with our youth, Dharani. They are giving 24 hours electricity well. They are cutting it for one, two, or three hours at night; they used to give it for 12 hours, from 5:00 p.m. to 12:00 a.m. Now they cut it at five and give it at six in the morning. There is no fixed time from five to six. Sometimes it goes off from above, and then it stays off until morning, for four or five hours. They give it only if a message comes from Warangal; if it goes from Pochamp then they give it. We are परेशान (troubled) about electricity. The fields are not getting proper water; there are some difficulties for the fields. After giving electricity, they put an app in our village; two bags per acre are not available on time. They keep saying online sale, and we do not know when it will stop. There is no stock in the godowns. We are facing a little lot of difficulties. Agriculture is having a lot of difficulties.

agricultural-powerfertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“A farmer from Balkonda says he is facing problems with electricity supply and fertilizer availability, including not getting fertilizer on time and stock not being available in godowns.” · confidence 86%

Sentiment: negativeStance toward government: criticalTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4686ms)

Processing trail
  1. NORMALIZED · 16 Sept, 19:48
  2. RELEVANCE_ACCEPTED · 16 Sept, 19:50
  3. ENRICHED · 16 Sept, 19:56
  4. DEDUPED · 16 Sept, 19:57
  5. NARRATIVE_ASSIGNED · 16 Sept, 19:57
  6. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  7. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 11:07
  10. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  11. NARRATIVE_ASSIGNED · 17 Sept, 21:04
  12. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  13. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  14. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  15. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  16. NARRATIVE_ASSIGNED · 20 Sept, 15:40
  17. NARRATIVE_ASSIGNED · 23 Sept, 02:44

mention 631f018e · raw item dd529f38 · origin live

YouTubeJournalist SrinivasJournalist97%16 Sept, 13:30 IST
District not evidencedTelugustance: neutral2 views · 0 likes · 0 comments

కౌలు రైతులకు భరోసా ఏది? | Telangana Tenant Farmers Issues | Rythu Bharosa 2026 | Journalist Srinivas

Original — Telugu

కౌలు రైతులకు భరోసా ఏది? | Telangana Tenant Farmers Issues | Rythu Bharosa 2026 | Journalist Srinivas

Show full source text as published

కౌలు రైతులకు భరోసా ఏది? | Telangana Tenant Farmers Issues | Rythu Bharosa 2026 | Journalist Srinivas కౌలు రైతులకు భరోసా ఏది? | Telangana Tenant Farmers Issues | Rythu Bharosa 2026 | Journalist Srinivas #TenantFarmers #KauluRythulu #RythuBharosa #TelanganaFarmers #FarmersIssues #TelanganaAgriculture #TelanganaNews #CMRevanthReddy #ThummalaNageswaraRao #JournalistSrinivas

English · AI translation

Hello, greetings. I am Journalist Srinivas. Across Telangana, hopes have risen for tenant farmers. The Congress party promised in its manifesto to support tenant farmers, and in the 2023 elections they promised that Rythu Bharosa would also be given to tenant farmers; they did give it once. But tenant farmers are now waiting for a legal right and for recognition. There are several lakh tenant farmers across Telangana. Because they are not recognised, they are not receiving the benefits due to them, such as bank loans, waivers, or subsidised fertilisers. A farmer is recognised only if he has a pattadar passbook and land, or else the government should identify tenant farmers and give tenant farmer certificates; the Congress party said before coming to power that it would do that. It is said that some exercise is now underway on that. There is news that some relief is coming for tenant farmers. After the Revanth Reddy government came to power, a Farmer Commission was set up. Based on the recommendations of that Farmer Commission, tenant farmer identity cards may be issued. Naturally, when tenant farmers are mentioned, landowners and pattadars worry. Those who have leased out their land worry, and farmers who took land on lease worry. There is a Tenant Farmers Protection Act, and under the law from 1950, there was a rule that the land would go to the person who gave it on lease; because of that, this was faced earlier. So in every situation, lease agreements are not written on paper. Landowners do not agree to write them. The government has been saying for many days that without written records, recognition cannot be given. Now this government is thinking about whether to repeal that law itself. There is a Tenancy Act, and one idea is to repeal it and remove the doubts of landowners first. If the law cannot be repealed, then let us recognise tenant farmers ourselves. The government can conduct an enquiry without a landlord affidavit or landlord papers, identify that this person is a tenant farmer and cultivates so many acres, and issue a recognition certificate. Based on that certificate, they can take loans from banks, take subsidised fertilisers, get various seeds on subsidy, and sell the crop they have grown. Tenant farmers are in very dire conditions. When the government procures produce like maize, paddy, or cotton at procurement centres, tenant farmers do not have an option there and have to somehow persuade some other farmer to sell there on their behalf. They face difficulties because they do not have pattadar passbooks or tenant farmer certificates when getting urea or other fertiliser bags. If they go to the bank, the bank does not give loans. Tenant farmers face many kinds of difficult situations. If a farmer is given the investment support he needs, the seeds he needs, or subsidised fertilisers, he can cultivate; even if all that is given, cultivation is difficult in view of weather conditions. Without any of this, the tenant must pay lease rent. The landowner farmer, the owner, and the government do not provide even one rupee of support, neither in the form of loans nor subsidies nor seeds, and there is no encouragement in selling the harvested crop. How should this be done? How can tenant farmers survive? The Revanth Reddy government is now said to be thinking actively about this and, based on the Farmer Commission report, it should stand as a protective shield for them. In every situation, just as the government provides all kinds of facilities to a farmer with a pattadar passbook, it should legally do the same for them too. One major step in this is whether to repeal the tenant farmers’ tenancy law, or if repeal is not possible, to make another law that gives the same level of protection. This is said to be a very good scheme that would bring goodwill to the Congress party and the government, because there are several lakh farmers. After KCR brought Dharani and after KCR brought Rythu Bandhu, only landowning farmers were looked after and tenant farmers were not looked after or recognised. Because of that, they were very dissatisfied and voted for the Congress party. In such a situation, the Congress party and the government now have the opportunity to catch that issue. If they truly take it up, there is a discussion that the Farmer Commission report will be implemented. If that happens, it would bring relief to several lakh farmers. From their perspective, the Revanth Reddy government thinks like this, and they also think about the Revanth Reddy government and the Congress party from that perspective. This is today’s development.

farmer-support-schemesagricultural-creditinput-costseedsfertilizer-availabilityprocurementrythu-bharosa-paymentmaizepaddycottonrythu-bharosa
Open original source ↗
AI interpretation & provenance
Extracted claim

“The content says tenant farmers in Telangana may be given recognition certificates based on a farmer commission report, which could help them access loans, subsidised fertiliser, seeds, and procurement benefits.” · confidence 79%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 7146ms)

Processing trail
  1. NORMALIZED · 16 Sept, 23:51
  2. RELEVANCE_ACCEPTED · 16 Sept, 23:54
  3. ENRICHED · 17 Sept, 00:00
  4. DEDUPED · 17 Sept, 00:01
  5. NARRATIVE_ASSIGNED · 17 Sept, 00:01
  6. NARRATIVE_ASSIGNED · 17 Sept, 00:02
  7. NARRATIVE_ASSIGNED · 17 Sept, 00:03
  8. NARRATIVE_ASSIGNED · 17 Sept, 00:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 00:06
  10. NARRATIVE_ASSIGNED · 17 Sept, 00:06
  11. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  12. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  13. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  14. NARRATIVE_ASSIGNED · 17 Sept, 21:03
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  18. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  19. NARRATIVE_ASSIGNED · 20 Sept, 19:44
  20. NARRATIVE_ASSIGNED · 22 Sept, 02:32
  21. NARRATIVE_ASSIGNED · 22 Sept, 14:24
  22. NARRATIVE_ASSIGNED · 23 Sept, 02:39

mention 073bf9f0 · raw item cf5f93e9 · origin live

YouTubeMF Agri Farm solutions Creator78%15 Sept, 06:00 IST
District not evidencedTelugu / Englishstance: neutral1,193 views · 26 likes · 0 comments

Banana farming Updates #manikantafertilizers #viral #viralreels #newpost #trending #trendingshorts

Original — Telugu / English

Banana farming Updates Banana daily updates కోసం మా channel ni fallow avvandi organic fertilizer for plants in telugu money plant growth fertilizer telugu npk fertilizer how to use in telugu how to use banana peels as fertilizer fertilizer business ideas telugu agriculture farming business ideas telugu how to make banana liquid fertilizer organic farming fertilizer methods agriculture fertilizer machine jeevamrutham organic fertilizer humic acid fertilizer telugu banana crop cultivation in telug ,potash fertilizer price,20 20 13 fertilizer,new fertilizer rates in telangana,new fertilizer rates in andhrapradesh DAP, Urea, SSP, MOP, Potash, NPK ఎరువుల ధరల్లో ఆగస్టు 2026లో భారీ మార్పులు వచ్చాయి. Fertilizer Price 2026, DAP Price Today, Urea Price Today, Urea New Rate, Fertilizer Rates Update, New Fertilizer Rates 2026 గురించి పూర్తి వివరాలు ఈ వీడియోలో తెలుసుకోండి. తెలంగాణ మరియు ఆంధ్రప్రదేశ్ రైతులు ఎరువులు కొనుగోలు చేసే ముందు తప్పక తెలుసుకోవాల్సిన తాజా ధరలు, ధర పెరుగుదల మరియు FFS Digital System వివరాలు ఇందులో ఉన్నాయి. ఆగస్టు 2026లో DAP ధర ఎంత? DAP పాత ధర ఎంత? DAP కొత్త ధర ఎంత? Urea ధర ఎంత? Urea ధర ఎందుకు పెరగలేదు? Ureaపై ప్రభుత్వం ఎంత సబ్సిడీ ఇస్తోంది? Urea బస్తా రైతులకు ఎంత ధరకు లభిస్తుంది? SSP కొత్త ధర ఎంత? MOP ధర ఎంత? Potash ధర ఎంత? Ammonium Sulphate ధర ఎంత? NPK 15:15:15​ ధర ఎంత? NPK 24:24:00​ ధర ఎంత? NPK 10:26:26​ ధర ఎంత? NPK 16:16:16​ ధర ఎంత? NPK 14:35:14​ ధర ఎంత? NPK 12:32:16​ ధర ఎంత? NPK 19:19:19​ ధర ఎంత? ఏ ఎరువు ధర ఎక్కువగా పెరిగింది? DAP ధర ఎందుకు పెరిగింది? indoor plants fertilizer in telugu telugu truck traveller jagan youtube channel agromin max fertilizer telugu how to use banana peel fertilizer for plants humic acid uses in agriculture haritha gogineni astrologer dap fertilizer for plants telugu paddy fertilizer management in telugu banana crop cultivation in telugu organic npk fertilizer at home vangara srinivasa murthy astrologer fruit tree fertilizer organic

Show full source text as published

Banana farming Updates #manikantafertilizers #viral #viralreels #newpost #trending #trendingshorts Banana daily updates కోసం మా channel ni fallow avvandi organic fertilizer for plants in telugu money plant growth fertilizer telugu npk fertilizer how to use in telugu how to use banana peels as fertilizer fertilizer business ideas telugu agriculture farming business ideas telugu how to make banana liquid fertilizer organic farming fertilizer methods agriculture fertilizer machine jeevamrutham organic fertilizer humic acid fertilizer telugu banana crop cultivation in telug dap, urea, ssp, mop, potash, ureaprice, fertilizer in telugu, fertilizer price 2026, fertilizer price update, DAP price today, urea price today, urea new rate, fertilizer latest news, fertilizer rates, paddy, cotton, vari, varisagu, aruvala retlu, fertilizer prices, fertilizer, loss, fertilizer rates update, new fertlizer rates 2026, new fertilizer rates,framework for fertilizer sale app telugu,dap price,fertilizer,agriculture,dap rate,dap fertilizer price,15 15 15 fertilizer ,potash fertilizer price,20 20 13 fertilizer,new fertilizer rates in telangana,new fertilizer rates in andhrapradesh DAP, Urea, SSP, MOP, Potash, NPK ఎరువుల ధరల్లో ఆగస్టు 2026లో భారీ మార్పులు వచ్చాయి. Fertilizer Price 2026, DAP Price Today, Urea Price Today, Urea New Rate, Fertilizer Rates Update, New Fertilizer Rates 2026 గురించి పూర్తి వివరాలు ఈ వీడియోలో తెలుసుకోండి. తెలంగాణ మరియు ఆంధ్రప్రదేశ్ రైతులు ఎరువులు కొనుగోలు చేసే ముందు తప్పక తెలుసుకోవాల్సిన తాజా ధరలు, ధర పెరుగుదల మరియు FFS Digital System వివరాలు ఇందులో ఉన్నాయి. 📌 ఈ వీడియోలో మీరు తెలుసుకునే ముఖ్యాంశాలు 🔹 ఆగస్టు 2026 ఎరువుల కొత్త ధరలు 🔹 DAP Price Today – DAP ధర ఎంత? 🔹 Urea Price Today – యూరియా ధర ఎంత? 🔹 Ureaపై ప్రభుత్వం ఇస్తున్న సబ్సిడీ 🔹 SSP కొత్త ధర ఎంత? 🔹 MOP / Potash కొత్త ధర ఎంత? 🔹 Ammonium Sulphate కొత్త ధర 🔹 NPK 15:15:15​ కొత్త ధర 🔹 NPK 24:24:00​ కొత్త ధర 🔹 NPK 10:26:26​ కొత్త ధర 🔹 20:20:00:13 కొత్త ధర 🔹 16:20:00:13 కొత్త ధర 🔹 NPK 16:16:16​ కొత్త ధర 🔹 NPK 14:35:14​ కొత్త ధర 🔹 NPK 12:32:16​ కొత్త ధర 🔹 NPK 19:19:19​ ధర భారీగా పెరిగిందా? 🔹 ఏ ఎరువుపై ఎక్కువ ధర పెరిగింది? 🔹 ఏ ఎరువుల ధరలో మార్పు లేదు? 🔹 DAP కొరత మరియు మార్కెట్ ధర 🔹 Fertilizer Black Market నుంచి రైతులు ఎలా జాగ్రత్త పడాలి? 🔹 FFS – Framework for Fertilizer Sale Digital System అంటే ఏమిటి? 🔹 Farmer Fertilizer Sale App ఎలా పనిచేస్తుంది? 🔹 మొబైల్ ద్వారా ఎరువుల కోసం ఎలా అప్లై చేయాలి? 🔹 సమీపంలోని Dealer / Society ఎలా ఎంచుకోవాలి? 🔹 QR Code Token ఎలా వస్తుంది? 🔹 QR Code ద్వారా ఎరువులు ఎలా తీసుకోవాలి? 🔹 సబ్సిడీ ఎరువులు సరైన ధరకు ఎలా కొనాలి? 🔹 ఎరువులు కొనేముందు AO వద్ద ధర ఎలా నిర్ధారించుకోవాలి? ❓ రైతులు తరచుగా అడిగే ప్రశ్నలు ఆగస్టు 2026లో DAP ధర ఎంత? DAP పాత ధర ఎంత? DAP కొత్త ధర ఎంత? Urea ధర ఎంత? Urea ధర ఎందుకు పెరగలేదు? Ureaపై ప్రభుత్వం ఎంత సబ్సిడీ ఇస్తోంది? Urea బస్తా రైతులకు ఎంత ధరకు లభిస్తుంది? SSP కొత్త ధర ఎంత? MOP ధర ఎంత? Potash ధర ఎంత? Ammonium Sulphate ధర ఎంత? NPK 15:15:15​ ధర ఎంత? NPK 24:24:00​ ధర ఎంత? NPK 10:26:26​ ధర ఎంత? NPK 16:16:16​ ధర ఎంత? NPK 14:35:14​ ధర ఎంత? NPK 12:32:16​ ధర ఎంత? NPK 19:19:19​ ధర ఎంత? ఏ ఎరువు ధర ఎక్కువగా పెరిగింది? DAP ధర ఎందుకు పెరిగింది? indoor plants fertilizer in telugu telugu truck traveller jagan youtube channel agromin max fertilizer telugu how to use banana peel fertilizer for plants humic acid uses in agriculture haritha gogineni astrologer dap fertilizer for plants telugu paddy fertilizer management in telugu banana crop cultivation in telugu organic npk fertilizer at home vangara srinivasa murthy astrologer fruit tree fertilizer organic DAP, Urea, SSP, MOP, Potash, Urea Price, Urea Price Today, Urea New Rate, DAP Price Today, DAP Rate Today, Fertilizer Price 2026, Fertilizer Price Today, Fertilizer Price Update, Fertilizer Rates, Fertilizer Rates Update, New Fertilizer Rates, New Fertilizer Rates 2026, Fertilizer Latest News, Fertilizer Prices, Fertilizer in Telugu, DAP Price 2026, Urea Price 2026, SSP Price, MOP Price, Potash Price, NPK Fertilizer Price, NPK 19:19:19​ Price, NPK Fertilizer Rates, Complex Fertilizer Price, Fertilizer Subsidy, Fertilizer Subsidy India, DAP Shortage, DAP Latest Update, Urea Latest Update, Fertilizer Latest Update, Agriculture News Telugu, Farmer News Telugu, Telangana Agriculture, Andhra Pradesh Agriculture, Telangana Farmers, AP Farmers, Paddy Fertilizer, Cotton Fertilizer, Vari Sagu, Paddy Farming, Cotton Farming, ఎరువుల ధరలు, ఎరువుల కొత్త ధరలు, డీఏపీ ధర, యూరియా ధర, ఎస్‌ఎస్‌పీ ధర, ఎంఓపీ ధర, పొటాష్ ధర, ఎన్‌పీకే ధరలు, వ్యవసాయ ఎరువులు, రైతుల వార్తలు, వ్యవసాయ వార్తలు. #FertilizerPrice2026​ #DAPPrice​ #UreaPrice​ #FertilizerRates​ #FertilizerUpdate​ #dap​ #urea​ #npk​ #mop​ #ssp​ #agriculturetelugu​ #farmernews​ #telanganafarmers​ #AndhraPradeshFarmers​ #KatyayaniTelugu​ #manikantafertilizers

English · AI translation

Banana farming Updates #manikantafertilizers #viral #viralreels #newpost #trending #trendingshorts Banana farming Updates Please follow our channel for daily banana updates. Organic fertilizer for plants in Telugu Money plant growth fertilizer Telugu NPK fertilizer how to use in Telugu How to use banana peels as fertilizer Fertilizer business ideas Telugu Agriculture farming business ideas Telugu How to make banana liquid fertilizer Organic farming fertilizer methods Agriculture fertilizer machine Jeevamrutham organic fertilizer Humic acid fertilizer Telugu Banana crop cultivation in Telugu Potash fertilizer price, 20 20 13 fertilizer, new fertilizer rates in Telangana, new fertilizer rates in Andhra Pradesh. In August 2026, there have been big changes in the prices of DAP, Urea, SSP, MOP, Potash, and NPK fertilizers. Learn full details in this video about fertilizer price 2026, DAP price today, Urea price today, Urea new rate, fertilizer rates update, and new fertilizer rates 2026. Telangana and Andhra Pradesh farmers should know the latest prices, price increases, and FFS Digital System details before purchasing fertilizers. What is the DAP price in August 2026? What was the old DAP price? What is the new DAP price? What is the Urea price? Why did the Urea price not increase? How much subsidy does the government give on Urea? At what price is a bag of Urea available to farmers? What is the new SSP price? What is the MOP price? What is the Potash price? What is the Ammonium Sulphate price? What is the NPK 15:15:15 price? What is the NPK 24:24:00 price? What is the NPK 10:26:26 price? What is the NPK 16:16:16 price? What is the NPK 14:35:14 price? What is the NPK 12:32:16 price? What is the NPK 19:19:19 price? Which fertilizer price increased the most? Why did the DAP price increase? Indoor plants fertilizer in Telugu Telugu truck traveller jagan youtube channel Agromin max fertilizer Telugu How to use banana peel fertilizer for plants Humic acid uses in agriculture Haritha gogineni astrologer DAP fertilizer for plants Telugu Paddy fertilizer management in Telugu Banana crop cultivation in Telugu Organic NPK fertilizer at home Vangara Srinivasa Murthy astrologer Fruit tree fertilizer organic

pest-outbreakfertilizer-availabilityhorticulture
Open original source ↗
AI interpretation & provenance
Extracted claim

“A pest is damaging banana plants, and the speaker says spraying certain medicines is a way to prevent it.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 76%Agriculture relevance: 98%Classification confidence: 84%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4013ms)

Processing trail
  1. NORMALIZED · 15 Sept, 14:26
  2. RELEVANCE_ACCEPTED · 15 Sept, 14:29
  3. ENRICHED · 15 Sept, 14:35
  4. DEDUPED · 15 Sept, 14:36
  5. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  6. NARRATIVE_ASSIGNED · 15 Sept, 14:42
  7. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention e86aa95a · raw item 3a8dc6e5 · origin live

YouTubeBRK AgricultureMedia organisation91%13 Sept, 06:15 IST
District not evidencedTelugustance: neutral9,005 views · 80 likes · 0 comments

రైతులకు శుభవార్త! KCCతో తక్కువ వడ్డీకే రుణం | Farmer Loan at Just 4% Interest?@brkagriculture

Original — Telugu

తెలంగాణ రైతు సోదరులకు ముఖ్య గమనిక! 🌾📢 పంట పెట్టుబడుల కోసం అధిక వడ్డీకి అప్పులు చేయాల్సిన అవసరం లేకుండా కేంద్ర ప్రభుత్వం అందిస్తున్న కిసాన్ క్రెడిట్ కార్డ్ (KCC) గురించి తెలుసుకోండి. ఈ వీడియోలో:

Show full source text as published

రైతులకు శుభవార్త! KCCతో తక్కువ వడ్డీకే రుణం | Farmer Loan at Just 4% Interest?@brkagriculture తెలంగాణ రైతు సోదరులకు ముఖ్య గమనిక! 🌾📢 పంట పెట్టుబడుల కోసం అధిక వడ్డీకి అప్పులు చేయాల్సిన అవసరం లేకుండా కేంద్ర ప్రభుత్వం అందిస్తున్న కిసాన్ క్రెడిట్ కార్డ్ (KCC) గురించి తెలుసుకోండి. ఈ వీడియోలో: ✅ KCC అంటే ఏమిటి? ✅ KCC ద్వారా రైతులకు ఎంత వరకు రుణం లభిస్తుంది? ✅ 7% వడ్డీపై రుణం, సకాలంలో చెల్లిస్తే 3% వడ్డీ రాయితీ ఎలా లభిస్తుంది? ✅ విత్తనాలు, ఎరువులు, పంట కోత ఖర్చులకు KCC నిధులను ఎలా ఉపయోగించుకోవచ్చు? ✅ పశుపోషణ, కోళ్ల పెంపకం, చేపల పెంపకానికి KCC ఎలా ఉపయోగపడుతుంది? ✅ సొంత భూమి లేని కౌలు రైతులు, భాగస్వామ్య రైతులు అర్హులా? ✅ KCC కోసం ఎక్కడ, ఎలా దరఖాస్తు చేసుకోవాలి? 🌱 పంట పెట్టుబడుల కోసం KCC వంటి అధికారిక రుణ సదుపాయాల గురించి తెలుసుకుని, మీ సమీప బ్యాంక్ లేదా వ్యవసాయ అధికారులను సంప్రదించండి. 👍 Like | 💬 Comment | 📤 Share | 🔔 Subscribe #KisanCreditCard #KCC #TelanganaFarmers #TelanganaAgriculture #FarmerLoans #KCCLoan #AgricultureTips #FarmerAwareness #KisanCreditCardTelugu #Rythu

English · AI translation

Good news for farmers! Learn about the Kisan Credit Card (KCC), which is provided by the Central Government, so that you do not have to take high-interest loans for crop investment. In this video: Happy news for farmer brothers. There is no need to depend on moneylenders for crop investment anymore. Through the Kisan Credit Card (KCC) provided by the Central Government, loans can be obtained at very low interest. Through this card, the interest rate on loans obtained from banks is 7%. Moreover, if the taken loan is repaid on time, a 3% benefit is received and the loan is available at only 4% interest. In addition, without any collateral security or surety, one can obtain loans up to several lakh rupees. The funds from this KCC can be easily used not only for buying seeds and fertilizers, but also for crop harvesting expenses, livestock rearing, poultry farming, and fish pond management. Apart from farmers with their own land, tenant farmers, sharecroppers, and women self-help groups are also eligible for this KCC card. Contact your nearest bank today and get KCC. Do not forget to share this information with fellow farmers as well.

agricultural-creditinput-costseedsfertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Under the Kisan Credit Card (KCC), farmers can get loans at 7% interest, and if repaid on time the effective interest rate becomes 4%.” · confidence 93%

Sentiment: positiveStance toward government: neutralTelangana relevance: 85%Agriculture relevance: 98%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4563ms)

Processing trail
  1. NORMALIZED · 14 Sept, 12:46
  2. RELEVANCE_ACCEPTED · 14 Sept, 12:50
  3. ENRICHED · 14 Sept, 12:55
  4. DEDUPED · 14 Sept, 12:58
  5. NARRATIVE_ASSIGNED · 14 Sept, 12:59
  6. NARRATIVE_ASSIGNED · 14 Sept, 12:59
  7. NARRATIVE_ASSIGNED · 14 Sept, 13:02
  8. NARRATIVE_ASSIGNED · 14 Sept, 13:02
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  10. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  11. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  12. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  14. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  15. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  16. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  17. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  18. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  19. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  20. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  21. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  22. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention fe91d21d · raw item 3030191f · origin live

NewsTelangana Today — Telangana deskMedia organisation98%12 Sept, 18:47 IST
Khammam · vemsoor (98% conf.)Englishstance: critical

Khammam: Farmers lay siege to substation at Kandukur over power cuts

Original — English

Khammam: Farmers at Kandukur of Vemsoor mandal in the district took out a rally on Saturday and laid siege to the local electrical substation in protest against power outages. A large number of farmers from Kandukur, Duddupudi, Bharanipadu and Lachannagudem took part in the protest expressing anger at the Congress government, which had promised 24-hour free electricity but failed to ensure even a seven-hour uninterrupted supply. Former Sathupalli MLA Sandra Venkata Veeraiah extended his solidarity with the protesting farmers. Speaking on the occasion, he recalled that former Chief Minister K Chandrashekhar Rao had taken up the challenge posed by the then-Chief Minister of undivided Andhra Pradesh, who had remarked that if Telangana was formed, people would only use power lines to dry clothes and ensured 24-hour free electricity for farmers in the State. While questioning the government why power cuts were being imposed again in the State, Veeraiah accused the Revanth Reddy government of failing to plan adequately for the farmers' electricity needs. It was the government's duty to provide quality, uninterrupted power to farmers, even if it meant purchasing electricity from other States to safeguard crops, he said. He further stated that the government was causing difficulties for farmers in fertiliser supply as well. Creating hurdles for farmers through an app-based fertiliser distribution system was inappropriate as many farmers do not own smartphones and fertilisers should be supplied using the earlier coupon system by ensuring availability of adequate stocks, he demanded. Veeraiah checked the supply logbook at the substation to verify actual duration of power supply and the frequency of interruptions experienced by farmers. If the electricity issue was not resolved immediately the protests by the farmers would be intensified, he warned.

agricultural-powerfertilizer-availabilitypaddy
Open original source ↗
AI interpretation & provenance
Extracted claim

“Farmers at Kandukur in Vemsoor mandal of Khammam district laid siege to a local electrical substation in protest against power outages.” · confidence 99%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2169ms)

Processing trail
  1. NORMALIZED · 12 Sept, 19:48
  2. RELEVANCE_ACCEPTED · 12 Sept, 19:52
  3. ENRICHED · 12 Sept, 19:54
  4. DEDUPED · 12 Sept, 19:55
  5. NARRATIVE_ASSIGNED · 12 Sept, 19:55
  6. NARRATIVE_ASSIGNED · 12 Sept, 19:59
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:22
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:47
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  14. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  15. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  16. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  17. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  18. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  19. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  20. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  21. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  22. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  23. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  24. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 56d08485 · raw item 6219aa6e · origin live

YouTubeAAN MediaMedia organisation97%12 Sept, 13:15 IST
Mahabubabad · maripeda (99% conf.)Telugu / Englishstance: critical2,477 views · 59 likes · 2 comments

‘సారూ మీ కాల్మొక్తా కరెంట్ ఇవ్వండి'| #Farmers #FarmerProtest #ElectricityCrisis #PowerCut #AANMEDIA

Original — Telugu / English

‘సారూ మీ కాల్మొక్తా కరెంట్ ఇవ్వండి'| ‘సారూ మీ కాల్మొక్తా కరెంట్ ఇవ్వండి'| అన్నదాత ఆవేదనకు అద్దం పడుతున్న దృశ్యం | “Sir, please give us electricity!” Heartbreaking visuals of farmers pleading with officials at the Ellampet substation in Maripeda Mandal, Mahabubabad district, have left many deeply moved. With their crops drying before their eyes, helpless farmers were forced to beg for power to save their livelihoods. This problem is not limited to one village or district. Farmers across the country struggle with irregular electricity, long queues for fertilizers, water shortages, delayed government benefits, and financial difficulties. They spend sleepless nights guarding their fields and run from offices and banks for assistance. Despite being called the backbone of the nation, farmers continue to suffer, desperately waiting for better days.

Show full source text as published

‘సారూ మీ కాల్మొక్తా కరెంట్ ఇవ్వండి'| #Farmers #FarmerProtest #ElectricityCrisis #PowerCut #AANMEDIA ‘సారూ మీ కాల్మొక్తా కరెంట్ ఇవ్వండి'| అన్నదాత ఆవేదనకు అద్దం పడుతున్న దృశ్యం | #Farmers #FarmerProtest #ElectricityCrisis #PowerCut #AANMEDIA “Sir, please give us electricity!” Heartbreaking visuals of farmers pleading with officials at the Ellampet substation in Maripeda Mandal, Mahabubabad district, have left many deeply moved. With their crops drying before their eyes, helpless farmers were forced to beg for power to save their livelihoods. This problem is not limited to one village or district. Farmers across the country struggle with irregular electricity, long queues for fertilizers, water shortages, delayed government benefits, and financial difficulties. They spend sleepless nights guarding their fields and run from offices and banks for assistance. Despite being called the backbone of the nation, farmers continue to suffer, desperately waiting for better days. #Farmers #FarmerProtest #ElectricityCrisis #PowerCut #Agriculture #IndianFarmers #FarmersIssues #FarmerLife #Kisan #Annadata #Mahabubabad #Maripeda #Ellampet #TelanganaNews #TelanganaFarmers #FarmersStruggle #CropLoss #WaterCrisis #FertilizerShortage #GovernmentSchemes #FarmerSupport #RuralIndia #AgricultureNews #BreakingNews #ViralNews #AANMEDIA #AANTELUGU #AANMEDIATELUGU #AANNEWS #AANTELUGU #AANAP #AANMEDIA ========================================================== Subscribe to our channel to get latest news updates. For More Updates Follow Us On : AAN Media Facebook : https:// Twitter : https:// Instagram : https:// WhatsApp : https:// Follow us on Google News for Breaking and Latest News Updates: ==========================================================

English · AI translation

"Sir, please give us electricity!" The scene reflects the anguish of farmers. Heartbreaking visuals of farmers pleading with officials at the Ellampet substation in Maripeda Mandal, Mahabubabad district, because electricity was not coming properly have moved many to tears. As the crops they worked hard to grow dried up before their eyes, those farmer brothers were forced to hold the officials' feet and cry. This one incident shows how much those farmers suffered while trying to save their crops. However, these troubles are not limited to one village or one district. Today, farmers across the country are in the same situation. The farmer, who feeds everyone, has been reduced to a situation where he has to beg at officials' feet for every small thing. Other than boasting in microphones that the farmer is king, there is actually no one who cares about farmers. Farmers have to guard their fields all night without knowing when power will come or go. They have to stand in queues from morning till night in front of societies for fertilizer for their crops. Since water is not reaching the fields and borewells are drying up, the sufferings they endure to protect their crops are innumerable. On top of that, they have to run around offices and banks until their legs ache for government scheme money and investment support. Farmers across the country are seeing hell because the hard-earned crops are not getting a fair price and the debts taken are not being cleared. Everyone is waiting for the day when the condition of the farmer, who feeds the nation, changes and he can be happy.

agricultural-powerfertilizer-availabilityirrigationfarmer-support-schemes
Open original source ↗
AI interpretation & provenance
Extracted claim

“Farmers pleaded with officials at the Ellampet substation in Maripeda Mandal, Mahabubabad district, because electricity supply was irregular and their crops were drying.” · confidence 98%

Sentiment: negativeStance toward government: criticalTelangana relevance: 92%Agriculture relevance: 95%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4729ms)

Processing trail
  1. NORMALIZED · 14 Sept, 22:16
  2. RELEVANCE_ACCEPTED · 14 Sept, 22:18
  3. ENRICHED · 14 Sept, 22:25
  4. DEDUPED · 14 Sept, 22:26
  5. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  6. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:41
  15. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 16 Sept, 03:26
  18. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  19. NARRATIVE_ASSIGNED · 17 Sept, 00:05
  20. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  21. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  22. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  23. NARRATIVE_ASSIGNED · 17 Sept, 11:07
  24. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  25. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  26. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  27. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  28. NARRATIVE_ASSIGNED · 23 Sept, 02:43
  29. NARRATIVE_ASSIGNED · 23 Sept, 02:44
  30. NARRATIVE_ASSIGNED · 23 Sept, 13:03

mention d518fd7f · raw item 152aebfc · origin live

NewsThe Hindu — TelanganaMedia organisation98%9 Sept, 20:13 IST
District not evidencedEnglishstance: neutral

Agriculture Minister rules out scrapping fertiliser booking app

Original — English

Agriculture Minister rules out scrapping fertiliser booking app

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“The Agriculture Minister rules out scrapping the fertiliser booking app.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 90%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3061ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:33
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:35
  3. ENRICHED · 9 Sept, 22:36
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention cf639d74 · raw item 208e0636 · origin live

YouTubeT-SAT NetworkMedia organisation98%8 Sept, 05:01 IST
Suryapet (97% conf.)Telugustance: neutral913 views · 6 likes · 0 comments
Was live

🌾రైతుమిత్ర వ్యవసాయం | వానాకాలం వరి – సమగ్ర పోషక యాజమాన్యం | డా. కె. చంద్ర శేఖర్ | T-SAT

Original — Telugu

డా. కె. చంద్ర శేఖర్ కోఆర్డినేటర్ తెలంగాణ రైతు విజ్ఞాన కేంద్రం, సూర్యాపేట Our Channels Links 🎬 🎥 🔴 ▶ 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : ఏ ప్రభుత్వ ఉద్యోగానికి సిద్ధమౌతున్నా... తాజా సమాచారం కోసం లింక్ క్లిక్ చేసి గూగుల్ ఫామ్ లో నమోదు చేసుకోండి : 𝗧𝗼 𝗴𝗲𝘁 𝗹𝗮𝘁𝗲𝘀𝘁 𝘂𝗽𝗱𝗮𝘁𝗲𝘀 𝗳𝗼𝗿 𝗖𝗼𝗺𝗽𝗲𝘁𝗶𝘁𝗶𝘃𝗲 𝗘𝘅𝗮𝗺𝘀 𝗳𝗿𝗼𝗺 𝗧-𝗦𝗔𝗧 𝗘𝗻𝗿𝗼𝗹𝗹 𝘁𝗵𝗲 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : Please do Not issue a Copyright Strike against the Channel it affects our Channel and its non-profit organization. Previous work if Uploaded Song that is yours and you want it removed then Please Contact and We will Remove the Whole Video in less than 12 hours 📞Phone No :-7337558051, Email : - feedback-softnet@telangana.gov.in. T-SAT Network Digital Classes are Now Available on Following Platforms: 1. For Android Users: Play Store 2. For Apple Users: AppStore ---Watch on -Jio TV - Educational Genre & JIO TV+ -T-fiber HATHWAY 444 & 445 BRIGHTWAY 49 & 50 SITI VISION 39 & 40 SSC BARATHI 71 &72 RVR 133 & 134 SITI CABLE 38 & 39 BCN 851 & 852 D2H 2483 & 2484 GTPL 93 & 94

Show full source text as published

🌾రైతుమిత్ర వ్యవసాయం | వానాకాలం వరి – సమగ్ర పోషక యాజమాన్యం | డా. కె. చంద్ర శేఖర్ | T-SAT 🌾రైతుమిత్ర వ్యవసాయం | వానాకాలం వరి – సమగ్ర పోషక యాజమాన్యం | డా. కె. చంద్ర శేఖర్ | T-SAT 👨‍🌾 నిపుణులు: డా. కె. చంద్ర శేఖర్ కోఆర్డినేటర్ తెలంగాణ రైతు విజ్ఞాన కేంద్రం, సూర్యాపేట #రైతుమిత్రవ్యవసాయం #వానాకాలంవరి #వరి సాగు #సమగ్రపోషకయాజమాన్యం #వరి రైతులు #వ్యవసాయసలహాలు #తెలంగాణవ్యవసాయం #రైతుసమాచారం #పంటపోషకాలు #ఎరువులయాజమాన్యం #వానాకాలంపంటలు #వ్యవసాయవిజ్ఞానం #రైతుబంధు #TSAT #TSATHASTAGS #డాక్టర్కెచంద్రశేఖర్ #తెలుగువ్యవసాయం #అధికదిగుబడి #సుస్థిరవ్యవసాయం #సేంద్రీయవ్యవసాయం ---------------------------------------------------------- Our Channels Links 🎬 🎥 🔴 ▶ Please Subscribe & Get Updates: • T-SAT Network - https://www.youtube.com/TSATNetwork • T-SAT Agri - https://www.youtube.com/@TSATAgri • T-SAT Culture - https://www.youtube.com/@TSATCulture • T-SAT Health - https://www.youtube.com/@TSATHealth • T-SAT Nipuna - https://www.youtube.com/@TSATNipuna • T-SAT Vidya - https://www.youtube.com/@TSATVIDYA -------------------------------------------------------- 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : ఏ ప్రభుత్వ ఉద్యోగానికి సిద్ధమౌతున్నా... తాజా సమాచారం కోసం లింక్ క్లిక్ చేసి గూగుల్ ఫామ్ లో నమోదు చేసుకోండి : https://tinyurl.com/tsattv 𝗧𝗼 𝗴𝗲𝘁 𝗹𝗮𝘁𝗲𝘀𝘁 𝘂𝗽𝗱𝗮𝘁𝗲𝘀 𝗳𝗼𝗿 𝗖𝗼𝗺𝗽𝗲𝘁𝗶𝘁𝗶𝘃𝗲 𝗘𝘅𝗮𝗺𝘀 𝗳𝗿𝗼𝗺 𝗧-𝗦𝗔𝗧 𝗘𝗻𝗿𝗼𝗹𝗹 𝘁𝗵𝗲 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : https://tinyurl.com/tsattv Please do Not issue a Copyright Strike against the Channel it affects our Channel and its non-profit organization. Previous work if Uploaded Song that is yours and you want it removed then Please Contact and We will Remove the Whole Video in less than 12 hours 📞Phone No :-7337558051, Email : - feedback-softnet@telangana.gov.in. T-SAT Network Digital Classes are Now Available on Following Platforms: 👉Subscribe us on: https://www.youtube.com/tsatnetwork 👉Like us on: https://www.facebook.com/tsatnetwork 👉Follow us on: https://twitter.com/tsatnetwork 👉Follow us on: https://instagram.com/tsatnetwork 👉To Register & Watch on: https://www.tsat.tv 👉Install T-SAT App: 1. For Android Users: Play Store 2. For Apple Users: AppStore ---Watch on -Jio TV - Educational Genre & JIO TV+ -T-fiber 📡 📺𝗪𝗮𝘁𝗰𝗵 𝗧-𝗦𝗔𝗧 𝗩𝗜𝗗𝗬𝗔 & 𝗡𝗜𝗣𝗨𝗡𝗔 𝗖𝗵𝗮𝗻𝗻𝗲𝗹𝘀 𝗶𝗻 𝗕𝗲𝗹𝗼𝘄 𝗠𝗦𝗢 / 𝗖𝗮𝗯𝗹𝗲 𝗧𝗲𝗹𝗲𝘃𝗶𝘀𝗶𝗼𝗻 𝗡𝗲𝘁𝘄𝗼𝗿𝗸𝘀 HATHWAY 444 & 445 BRIGHTWAY 49 & 50 SITI VISION 39 & 40 SSC BARATHI 71 &72 RVR 133 & 134 SITI CABLE 38 & 39 BCN 851 & 852 D2H 2483 & 2484 GTPL 93 & 94

English · AI translation

🌾 Farmer Friend Agriculture | Kharif Paddy – Integrated Nutrient Management | Dr. K. Chandrasekhar | T-SAT Dr. K. Chandrasekhar Coordinator Telangana Rythu Vijnana Kendra, Suryapet Welcome to T-SAT. In today’s Farmer Friend Agriculture programme, we will discuss how to follow integrated nutrient management practices in kharif paddy and what precautions should be taken. To explain this topic, Dr. Chandrasekhar, Coordinator from Telangana Rythu Vijnana Kendra, Suryapet, is with us in the T-SAT studio. If you have any doubts on this topic, you can call the toll-free numbers scrolling on the screen and get your doubts clarified. What is integrated nutrient management? In recent times, when it comes to crop nutrition, farmers are relying mostly only on chemical fertilisers such as urea, DAP, potash and zinc sulphate. Instead of doing that, using organic sources such as vermicompost and cattle manure along with biofertilisers and chemical fertilisers together is called integrated nutrient management. What nutrients are mainly required for paddy? Generally, for any crop to complete its life cycle and produce seed again, 17 kinds of nutrients are required. Similarly, paddy also requires 17 nutrients. Among them, nitrogen, phosphorus and potassium are needed in higher quantities, so they are called primary nutrients. In addition, secondary nutrients such as calcium, magnesium and sulphur, and micronutrients especially iron and zinc are required in large amounts. Why are soil tests necessary for fertiliser management? Farmers use various fertilisers every year for crop production. After the Green Revolution, high-yielding varieties require more fertilisers to produce good yields, and as a result farmers have been using more fertilisers than needed. This increases nutrient levels in the soil. Also, some nutrients are naturally present in the soil even before fertilisers are applied. To know these levels, a soil test is absolutely necessary. Soil testing tells us the nutrient status of the soil, and if nutrient management is done accordingly, investment on fertilisers can be reduced and the soil can be kept healthy. Therefore, soil tests must be done. When should fertilisers be applied in paddy? There are long-duration paddy varieties like Samba Mysore and Siddhi that take more than 140 days, medium-duration varieties that take 130 to 140 days, and short-duration varieties that take 120 to 125 days. Long-duration varieties need fertiliser application four times during the crop life cycle, while short- and medium-duration varieties need three applications. For short- and medium-duration varieties, the first dose should be applied before transplanting in the final puddling, then once during tillering, and once at the panicle initiation stage. For long-duration varieties, fertilisers should be applied four times. The first dose should be given in the final puddling before transplanting, and then at intervals of every 15 to 20 days. What micronutrients does paddy need, and when should they be applied? Paddy usually has a high need for zinc and iron. Based on soil test results, the zinc and iron status in the soil should be checked before applying fertilisers. If these nutrients are sprayed when the crop shows deficiency symptoms, the plant recovers faster. Spraying on the crop provides relief, but it is only temporary. Therefore, after knowing the nutrient status of the soil, it is better to apply these fertilisers either together with other fertilisers or with a gap of two to three days. When should complex fertilisers be used in paddy? In paddy cultivation, farmers mainly use DAP and complex fertilisers such as 19-19, 39-19 and 20-3. These complex fertilisers contain phosphorus, which should be used for strong root development and root strengthening. Therefore, they should be applied before transplanting or, if that is not possible, within 15 days after transplanting. If farmers apply them later as top dressing, the nitrogen and potassium in the complex fertiliser support crop growth, but phosphorus is not useful then. As a result, phosphorus accumulates in the soil and may lead to zinc and iron deficiency. In recent times, the price of complex fertilisers has also increased by Rs. 250 to Rs. 500 per bag depending on the fertiliser, so complex fertilisers must be used only before puddling or within 15 days after transplanting. Should farmers apply all fertilisers at once or in splits? For example, for paddy, about two bags of urea, one bag of DAP and half a bag of potash are needed. If all are applied at once, the crop grows too vegetatively, becomes excessively leafy and may lodge. Also, plants do not use all the nutrients efficiently: with nitrogen, only about 50% is used by the plant, while the rest is wasted; with phosphorus, only 16 to 20% is used; and with potassium, about 60% is used. Since waste is higher when all fertilisers are applied together, it is better to apply urea and potassium in splits—four splits for long-duration varieties and three splits for short- and medium-duration varieties. Farmers are using more urea than recommended. What happens then? As mentioned earlier, two bags of urea are enough for one acre of paddy over the entire crop period of three to four months. However, in recent times, some farmers in the irrigated ayacut during the yasangi season are using up to five bags of urea in some places. This nitrogen promotes vegetative growth and the development of green colour in the plant. As a result, the plant becomes weak and even a mild breeze can cause lodging. Another problem is that because the crop becomes too lush and soft, pests and diseases attack it more easily and cause losses. Therefore, excessive urea is always harmful, and farmers should reduce its use. What is the role of potassium? Nitrogen, phosphorus and potassium are the three major nutrients and are more useful to plants than other nutrients. Recently, the price of potassium has risen to around Rs. 2600 per bag, so many farmers are not using it. Because deficiency symptoms are not clearly visible in crops, farmers assume potassium is not necessary...

fertilizer-availabilityinput-costpaddy
Open original source ↗
AI interpretation & provenance
Extracted claim

“For short- and medium-duration paddy varieties, fertilizers should be applied in three splits, while long-duration varieties require four splits.” · confidence 88%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 7984ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:24
  4. DEDUPED · 9 Sept, 18:27
  5. DEDUPED · 9 Sept, 22:39
  6. DEDUPED · 10 Sept, 01:29
  7. DEDUPED · 10 Sept, 03:50
  8. DEDUPED · 10 Sept, 05:57
  9. DEDUPED · 10 Sept, 10:46
  10. DEDUPED · 10 Sept, 15:37
  11. DEDUPED · 10 Sept, 19:44
  12. DEDUPED · 10 Sept, 23:22
  13. DEDUPED · 11 Sept, 02:01
  14. DEDUPED · 11 Sept, 04:16
  15. DEDUPED · 11 Sept, 06:22
  16. DEDUPED · 11 Sept, 11:21
  17. DEDUPED · 11 Sept, 16:06
  18. DEDUPED · 11 Sept, 20:29
  19. DEDUPED · 11 Sept, 23:49
  20. DEDUPED · 12 Sept, 02:45
  21. DEDUPED · 12 Sept, 05:01
  22. DEDUPED · 12 Sept, 06:57
  23. DEDUPED · 12 Sept, 11:57
  24. DEDUPED · 12 Sept, 16:42
  25. DEDUPED · 12 Sept, 19:55
  26. DEDUPED · 12 Sept, 23:00
  27. DEDUPED · 13 Sept, 01:07
  28. DEDUPED · 13 Sept, 03:26
  29. DEDUPED · 14 Sept, 12:58
  30. DEDUPED · 14 Sept, 16:37
  31. DEDUPED · 14 Sept, 22:26
  32. DEDUPED · 15 Sept, 02:25
  33. DEDUPED · 15 Sept, 05:22
  34. DEDUPED · 15 Sept, 09:11
  35. DEDUPED · 15 Sept, 14:36
  36. DEDUPED · 15 Sept, 19:52
  37. DEDUPED · 16 Sept, 00:04
  38. DEDUPED · 16 Sept, 03:18
  39. DEDUPED · 16 Sept, 05:40
  40. DEDUPED · 16 Sept, 09:41
  41. DEDUPED · 16 Sept, 14:44
  42. DEDUPED · 16 Sept, 19:57
  43. ENRICHED · 17 Sept, 00:01
  44. DEDUPED · 17 Sept, 00:01
  45. NARRATIVE_ASSIGNED · 17 Sept, 00:01
  46. NARRATIVE_ASSIGNED · 17 Sept, 00:06
  47. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  48. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  49. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  50. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  51. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  52. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 0362dc9a · raw item fc9dfe0c · origin live

YouTubeBIG TV Telugu NewsMedia organisation98%7 Sept, 13:06 IST
Mancherial (97% conf.)Telugu / Englishstance: neutral261 views · 0 comments

ఫెర్టిలైజర్ షాపు ముందు రైతు ఆందోళన| Farmer Protest At Fertilizers Shop In Mancherial District|BIG TV

Original — Telugu / English

Big TV Telugu News is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content.

Show full source text as published

ఫెర్టిలైజర్ షాపు ముందు రైతు ఆందోళన| Farmer Protest At Fertilizers Shop In Mancherial District|BIG TV ఫెర్టిలైజర్ షాపు ముందు రైతు ఆందోళన| Farmer Protest At Fertilizers Shop In Mancherial District|BIG TV Big TV Telugu News is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content. Connect with Us: 👉 Website: https://www.bigtvlive.com/ 👉 Facebook: https://www.facebook.com/BIGTVDigitalNews 👉 Twitter: https://x.com/bigtvtelugu 👉 WhatsApp: https://whatsapp.com/channel/0029VaAe49e72WTw8YM6zr3q 👉 Instagram: https://www.instagram.com/bigtv_telugu Subscribe to Big TV News for your dose of authentic, unfiltered Telugu content. Hit the bell icon to never miss an update. Let's grow together as the most informed community in Telugu politics and beyond!

English · AI translation

Farmer protest in front of a fertilizer shop | Farmer Protest At Fertilizers Shop In Mancherial District | BIG TV Big TV Telugu News is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers protested in front of a fertilizer shop in Mancherial district.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 85%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2079ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:34
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 28b2ed9d · raw item 7b9d2cd6 · origin live

YouTubeCVR News TeluguMedia organisation96%7 Sept, 09:28 IST
Medak (87% conf.)Telugustance: neutral410 views · 0 likes · 0 comments

ఎరువుల కోసం ఉదయం నుండి పడిగాపులు | Medak District Farmers Stretches | CVR News

Original — Telugu

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

ఎరువుల కోసం ఉదయం నుండి పడిగాపులు | Medak District Farmers Stretches | CVR News ఎరువుల కోసం ఉదయం నుండి పడిగాపులు | Medak District Farmers Stretches | CVR News #medakdistrict #formerprotest #telangana #breakingnews #raitheraju #cvrnews "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Waiting from morning for fertilizers | Medak District Farmers Stretches | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Medak district are waiting since morning for fertilizers.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2791ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 34d9bdbd · raw item 056dbf83 · origin live

XT-SAT Network@TSATnetworkMedia organisation90%6 Sept, 15:39 IST
Suryapet (97% conf.)Telugustance: neutral115 views · 0 likes · 0 reposts · 0 comments
Original — Telugu

వానాకాలం వరి – సమగ్ర పోషక యాజమాన్యం 🌾💧 డా. కె. చంద్ర శేఖర్ కోఆర్డినేటర్ తెలంగాణ రైతు విజ్ఞాన కేంద్రం, సూర్యాపేట ⏰ సాయంత్రం 4:00 నుండి 5:00 గంటల వరకు

Show full source text as published

🌾 వ్యవసాయం – రైతుల కోసం ప్రత్యేక ప్రత్యక్ష కార్యక్రమం 🌾 🌱 అంశం: వానాకాలం వరి – సమగ్ర పోషక యాజమాన్యం 🌾💧 👨‍🌾 నిపుణులు: డా. కె. చంద్ర శేఖర్ కోఆర్డినేటర్ తెలంగాణ రైతు విజ్ఞాన కేంద్రం, సూర్యాపేట 📅 సెప్టెంబర్ 07, సోమవారం ⏰ సాయంత్రం 4:00 నుండి 5:00 గంటల వరకు 📺 టీ-సాట్ ‘నిపుణ’ ప్రత్యక్ష ప్రసారం 📞 సంప్రదించవలసిన ఫోన్ నంబర్లు: ☎️ +91 9063190909 ☎️ +91 9063290909 🌐 https://t.co/CbPrirrDHL 📱 T-SAT App

English · AI translation

Monsoon-season paddy – integrated nutrient management 🌾💧 Dr. K. Chandra Shekhar Coordinator Telangana Rythu Vignana Kendram, Suryapet ⏰ From 4:00 PM to 5:00 PM

fertilizer-availabilitypaddy
Open original source ↗
AI interpretation & provenance
Extracted claim

“A program on monsoon-season paddy integrated nutrient management is scheduled from 4:00 PM to 5:00 PM, presented by Dr. K. Chandra Shekhar, Coordinator, Telangana Rythu Vignana Kendram, Suryapet.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 89%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2375ms)

Processing trail
  1. NORMALIZED · 7 Sept, 16:12
  2. RELEVANCE_ACCEPTED · 7 Sept, 16:19
  3. ENRICHMENT_FAILED · 7 Sept, 16:25
  4. ENRICHMENT_FAILED · 7 Sept, 18:33
  5. ENRICHMENT_FAILED · 7 Sept, 22:36
  6. ENRICHMENT_FAILED · 7 Sept, 22:44
  7. ENRICHMENT_FAILED · 7 Sept, 23:49
  8. ENRICHMENT_FAILED · 8 Sept, 00:55
  9. ENRICHED · 8 Sept, 01:53
  10. DEDUPED · 8 Sept, 02:10
  11. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  12. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  13. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  14. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  15. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  16. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  17. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  18. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  19. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  20. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  21. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  22. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  23. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention bfa00e59 · raw item cad5dbb5 · origin live

YouTubeCVR News TeluguMedia organisation96%5 Sept, 07:52 IST
Warangal · rayaparthi (98% conf.)Telugu / Englishstance: neutral745 views · 0 likes · 0 comments

వరంగల్ జిల్లాలో రాయపర్తి లో ఫర్టిలైజర్ యాప్ రచ్చ | Fertilizer App Stirs In Rayaparthi, Warangal

Original — Telugu / English

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

వరంగల్ జిల్లాలో రాయపర్తి లో ఫర్టిలైజర్ యాప్ రచ్చ | Fertilizer App Stirs In Rayaparthi, Warangal #raitheraju #warangal #fertilizer #yap#cvrnews వరంగల్ జిల్లాలో రాయపర్తి లో ఫర్టిలైజర్ యాప్ రచ్చ | Fertilizer App Stirs In Rayaparthi, Warangal "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

In Warangal district, there is a fertilizer app issue in Rayaparthi. | Fertilizer App Stirs in Rayaparthi, Warangal

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer app issue in Rayaparthi, Warangal district.” · confidence 78%

Sentiment: neutralStance toward government: neutralTelangana relevance: 96%Agriculture relevance: 95%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1943ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:26
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 5279c5cb · raw item eb03ff53 · origin live

YouTubeCVR News TeluguMedia organisation96%4 Sept, 15:13 IST
Medak (98% conf.)Englishstance: neutral1,157 views · 3 likes · 0 comments
Was live

Farmers Protest On Fertilizer Shortage In Medak District | CVR News

Original — English

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

Farmers Protest On Fertilizer Shortage In Medak District | CVR News #MedakDistrict #FertilizerShortage #TelanganaNews #BreakingNews #UreaShortageTelangana #CMRevanthReddy #FarmersProtest #CVRNews Farmers Protest On Fertilizer Shortage In Medak District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers protested over fertilizer shortage in Medak district.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1743ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:35
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:35
  3. ENRICHED · 9 Sept, 22:36
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention fc46e6ac · raw item 45d343b3 · origin live

XUday Polepaka | తెలంగాణ@PolepakaUdayPolitician92%3 Sept, 13:24 IST
Warangal (95% conf.)Telugustance: neutral117 views · 6 likes · 0 reposts · 0 comments
Original — Telugu

ఖిలా వరంగల్ తహసీల్దార్ కార్యాలయంలో వ్యవసాయం, రైతు బీమా, ఎరువుల సమస్యలపై MRO గారికి వినతిపత్రం సమర్పించిన శ్రీ @BRSNarenderWGL గారు, గ్రేటర్ వరంగల్ తొలి మేయర్, తూర్పు మాజీ శాసనసభ్యులు.

Show full source text as published

🌾 రైతు సమస్యలపై బీఆర్ఎస్ పోరుబాట! ✊🏻 ఖిలా వరంగల్ తహసీల్దార్ కార్యాలయంలో వ్యవసాయం, రైతు బీమా, ఎరువుల సమస్యలపై MRO గారికి వినతిపత్రం సమర్పించిన శ్రీ @BRSNarenderWGL గారు, గ్రేటర్ వరంగల్ తొలి మేయర్, తూర్పు మాజీ శాసనసభ్యులు. రైతు కోసం ప్రశ్నిస్తాం… రైతు కోసం పోరాడతాం! ✊🏻🌾 https://t.co/fgEH0s718f

English · AI translation

At the Khila Warangal Tahsildar office, a memorandum regarding agriculture, farmer insurance, and fertilizer problems was submitted to the MRO by Mr. @BRSNarenderWGL, Greater Warangal's first mayor and former East MLA.

fertilizer-availabilityfarmer-support-schemescrop-insurancerythu-bima
Open original source ↗
AI interpretation & provenance
Extracted claim

“A memorandum regarding agriculture, farmer insurance, and fertilizer problems was submitted to the MRO at the Khila Warangal Tahsildar office.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 80%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2093ms)

Processing trail
  1. NORMALIZED · 4 Sept, 01:04
  2. RELEVANCE_ACCEPTED · 4 Sept, 01:07
  3. ENRICHMENT_FAILED · 4 Sept, 01:19
  4. ENRICHMENT_FAILED · 4 Sept, 02:54
  5. ENRICHMENT_FAILED · 4 Sept, 06:21
  6. ENRICHMENT_FAILED · 4 Sept, 07:53
  7. ENRICHMENT_FAILED · 4 Sept, 09:16
  8. ENRICHMENT_FAILED · 4 Sept, 10:41
  9. ENRICHMENT_FAILED · 4 Sept, 13:26
  10. ENRICHMENT_FAILED · 4 Sept, 18:02
  11. ENRICHMENT_FAILED · 4 Sept, 20:33
  12. ENRICHMENT_FAILED · 4 Sept, 22:04
  13. ENRICHMENT_FAILED · 4 Sept, 23:32
  14. ENRICHMENT_FAILED · 5 Sept, 03:40
  15. ENRICHMENT_FAILED · 5 Sept, 06:36
  16. ENRICHMENT_FAILED · 5 Sept, 08:06
  17. ENRICHED · 5 Sept, 09:38
  18. DEDUPED · 5 Sept, 09:40
  19. NARRATIVE_ASSIGNED · 5 Sept, 09:42
  20. NARRATIVE_ASSIGNED · 5 Sept, 09:43
  21. ENRICHED · 8 Sept, 01:46
  22. DEDUPED · 8 Sept, 02:10
  23. NARRATIVE_ASSIGNED · 8 Sept, 02:16
  24. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  25. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  26. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  27. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  28. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  29. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  30. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  31. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  32. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  33. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  34. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  35. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 4298311c · raw item 5de25ef4 · origin live

YouTubeAR GROUP INDIADealer92%28 Aug, 18:37 IST
Warangal · sangem (84% conf.)Telugu / Englishstance: neutral279 views · 4 likes · 0 comments

PROMIN™ || FARMOVA || AUTHORISED DISTRIBUTOR AZAZ FERTILIZERS MONDRAI WARANGAL RIYAZ 7799527693

Original — Telugu / English

పంటకు అవసరమైన పోషణ అందించేందుకు సరైన ఎరువును ఎంచుకోవడం ఎంతో ముఖ్యం. ఈ వీడియోలో రైతు మరియు వ్యవసాయ ఉత్పత్తుల డీలర్ మధ్య జరిగే సంభాషణ ద్వారా PROMIN™ Organic Granulated Fertilizer గురించి పరిచయం చేస్తున్నాము. ఎజాజ్ ఫర్టిలైజర్స్ & పెస్టిసైడ్స్ గ్రా- మొండ్రాయి మ-సంగెం వరంగల్ జిల్లా 7799527693 FARMOVA GLOBAL వ్యవసాయానికి నాణ్యమైన పరిష్కారాలను అందించే మీ భాగస్వామి.

Show full source text as published

PROMIN™ || FARMOVA || AUTHORISED DISTRIBUTOR AZAZ FERTILIZERS MONDRAI WARANGAL RIYAZ 7799527693 🌱 రైతు పంటకు సరైన ఎరువు ఎంపిక ఏది? పంటకు అవసరమైన పోషణ అందించేందుకు సరైన ఎరువును ఎంచుకోవడం ఎంతో ముఖ్యం. ఈ వీడియోలో రైతు మరియు వ్యవసాయ ఉత్పత్తుల డీలర్ మధ్య జరిగే సంభాషణ ద్వారా PROMIN™ Organic Granulated Fertilizer గురించి పరిచయం చేస్తున్నాము. 🌾 PROMIN™ – Organic Granulated Fertilizer 🌱 పంటల పోషణ కోసం ఒక సేంద్రియ గ్రాన్యులర్ ఎరువు ఎంపిక 📞 *అధీకృత డిస్ట్రిబ్యూటర్* ఎజాజ్ ఫర్టిలైజర్స్ & పెస్టిసైడ్స్ గ్రా- మొండ్రాయి మ-సంగెం వరంగల్ జిల్లా 7799527693 FARMOVA GLOBAL వ్యవసాయానికి నాణ్యమైన పరిష్కారాలను అందించే మీ భాగస్వామి. #FarmovaGlobal #PROMIN #OrganicFertilizer #OrganicGranulatedFertilizer #TeluguFarmers #TeluguAgriculture #Farming #Agriculture #Farmers #CropNutrition #OrganicFarming

English · AI translation

PROMIN™ || FARMOVA || Authorised Distributor Azaz Fertilizers, Mondrai, Warangal, Riyaz 7799527693 It is very important to choose the right fertilizer to provide the nutrition required by the crop. In this video, we are introducing PROMIN™ Organic Granulated Fertilizer through a conversation between a farmer and an agricultural products dealer. Ejaz Fertilizers & Pesticides Gram: Mondrai, Mandal: Sangem, Warangal district 7799527693 FARMOVA GLOBAL Your partner in providing quality solutions for agriculture.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The video introduces PROMIN Organic Granulated Fertilizer through a conversation between a farmer and an agricultural products dealer.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 88%Agriculture relevance: 98%Classification confidence: 83%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2421ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:28
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 0ed0e1f5 · raw item 13b173e4 · origin live

YouTubeETV TelanganaMedia organisation96%28 Aug, 18:25 IST
Adilabad (98% conf.)Telugu / Englishstance: neutral565 views · 2 likes · 0 comments

ఆదిలాబాద్‌లో ఎరువుల కొరత.. కొత్త మండలాలు యాప్‌లో లేకపోవడమే కారణమా? || Ground Report

Original — Telugu / English

Farmers in the newly formed Boraj, Satnala and Sonala mandals of Adilabad district are reportedly facing difficulties in accessing fertilizers. The issue has emerged after the new mandals were not updated on the relevant agricultural app, affecting fertilizer availability for farmers. ETV’s ground report looks into the problem, the Agriculture Department’s response and the difficulties faced by farmers. ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. For More Latest Political and News Updates :

Show full source text as published

ఆదిలాబాద్‌లో ఎరువుల కొరత.. కొత్త మండలాలు యాప్‌లో లేకపోవడమే కారణమా? || Ground Report Farmers in the newly formed Boraj, Satnala and Sonala mandals of Adilabad district are reportedly facing difficulties in accessing fertilizers. The issue has emerged after the new mandals were not updated on the relevant agricultural app, affecting fertilizer availability for farmers. ETV’s ground report looks into the problem, the Agriculture Department’s response and the difficulties faced by farmers. #Adilabad #FertilizerShortage #FertilizerCrisis #Farmers #TelanganaFarmers #Agriculture #AgricultureNews #FarmerProblems #Boraj #Satnala #Sonala #FertilizerSupply ------------------------------------------------------------------------------------------------------------- #latestnewstelugutoday #etvtelanganalive #latestnewsupdate ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. WATCH ETV TELANGANA LIVE HERE: https://tinyurl.com/uvbvdx9x For More Latest Political and News Updates : SUBSCRIBE ► ETV Telangana : https://shorturl.at/lK94S #etvtelanganalive #BreakingNews #TrendingNews #LiveUpdates #LatestNews #ViralNews ETV Telangana Live is a 24/7 Telugu news television channel in Telangana and is a part of ETV Network dedicated to the Latest Political News, Live Reports, Exclusive Interviews, Breaking News, Sports News, Weather Updates, Entertainment, Business, and Current Affairs. ► Watch LIVE: https://bit.ly/3Orz2jn ► For Latest News : http://www.ts.etv.co.in ► Follow us on WhatsApp: https://whatsapp.com/channel/0029Va8RS5O2ER6coKrig41U ► Follow us on X : https://twitter.com/etvtelangana ► Follow us on Instagram : https://www.instagram.com/etvtelangana ► Subscribe to ETV Telangana : https://bit.ly/4ihMVyy ► Like us on Facebook: https://www.facebook.com/ETVTelangana ► Follow us on Threads: https://www.threads.net/@etvandhrapradesh ► ETV Telangana News App : https://f66tr.app.goo.gl/apps ►ETV Win Website : https://www.etvwin.com/ #etvtelangana #etvtelanganalive #EtvTelanganaNews #livenews #latestnews #etvandhrapradeshlive #TeluguNews #latestnews #latestnewstoday #latestnewsupdate #latestnewstelugutoday #latestnewstelugu

English · AI translation

Fertilizer shortage in Adilabad.. Is the reason that the new mandals are not in the app? || Ground Report Farmers in the newly formed Boraj, Satnala and Sonala mandals of Adilabad district are reportedly facing difficulties in accessing fertilizers. The issue has emerged after the new mandals were not updated on the relevant agricultural app, affecting fertilizer availability for farmers. ETV’s ground report looks into the problem, the Agriculture Department’s response and the difficulties faced by farmers. ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. For More Latest Political and News Updates :

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in the newly formed Boraj, Satnala and Sonala mandals of Adilabad district are facing difficulties in accessing fertilizers because the new mandals were not updated on the relevant agricultural app.” · confidence 97%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 98%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2202ms)

Processing trail
  1. NORMALIZED · 13 Sept, 03:25
  2. RELEVANCE_ACCEPTED · 13 Sept, 03:25
  3. ENRICHED · 13 Sept, 03:26
  4. DEDUPED · 13 Sept, 03:26
  5. NARRATIVE_ASSIGNED · 13 Sept, 03:26
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 9bff9a16 · raw item eaf19312 · origin live

YouTubeRaithu Nestham Telangana Media organisation78%28 Aug, 18:00 IST
District not evidencedTelugustance: neutral2,193 views · 40 likes · 0 comments

పోటాష్ లేకపోతే వరి దిగుబడి తగ్గుతుందా? పూర్తి నిజం ఇదే! | Paddy in benefits of the potash ( MOP )

Original — Telugu

రైతు సోదరులారా, వరి పంటలో మనం ఎక్కువగా యూరియా మరియు ఇతర ఎరువులపై దృష్టి పెడతాం. కానీ మొక్క ఎదుగుదల, కాండం బలం, నీటి వినియోగం, గింజల అభివృద్ధి మరియు పంట ఆరోగ్యానికి పొటాషియం ముఖ్యమైన పోషకం. వరి పంటకు పోటాష్ ఎందుకు అవసరం? పోటాష్ వేయడం వల్ల ఎలాంటి లాభాలు? పోటాష్ వేయకపోతే వచ్చే నష్టాలు? పోటాష్ లోపం లక్షణాలు ఏమిటి? అధిక యూరియా వాడకం వల్ల వచ్చే సమస్యలు మంచి దిగుబడికి సమతుల్య ఎరువుల నిర్వహణ ఎందుకు ముఖ్యం? వంటి ముఖ్యమైన విషయాలను సులభంగా వివరించాము. రైతు సోదరులందరికీ ఉపయోగపడే ఈ వీడియోను తప్పకుండా షేర్ చేయండి.

Show full source text as published

పోటాష్ లేకపోతే వరి దిగుబడి తగ్గుతుందా? పూర్తి నిజం ఇదే! | Paddy in benefits of the potash ( MOP ) రైతు సోదరులారా, వరి పంటలో మనం ఎక్కువగా యూరియా మరియు ఇతర ఎరువులపై దృష్టి పెడతాం. కానీ మొక్క ఎదుగుదల, కాండం బలం, నీటి వినియోగం, గింజల అభివృద్ధి మరియు పంట ఆరోగ్యానికి పొటాషియం ముఖ్యమైన పోషకం. వరి పంటకు పోటాష్ ఎందుకు అవసరం? పోటాష్ వేయడం వల్ల ఎలాంటి లాభాలు? పోటాష్ వేయకపోతే వచ్చే నష్టాలు? పోటాష్ లోపం లక్షణాలు ఏమిటి? అధిక యూరియా వాడకం వల్ల వచ్చే సమస్యలు మంచి దిగుబడికి సమతుల్య ఎరువుల నిర్వహణ ఎందుకు ముఖ్యం? వంటి ముఖ్యమైన విషయాలను సులభంగా వివరించాము. రైతు సోదరులందరికీ ఉపయోగపడే ఈ వీడియోను తప్పకుండా షేర్ చేయండి. ప్రతి ఒక్క వ్యవసాయ సమాచారం కోసం మన ఛానల్‌ను Subscribe చేసుకోండి. #PaddyFarming #RiceFarming #Potash #Potassium #PaddyCrop #PaddyFertilizer #RiceCrop #PotashBenefits #FertilizerManagement #Urea #Agriculture #TeluguAgriculture #Farmer #Raithu #RaithuNesthamTelangana #వరి #పోటాష్ #వ్యవసాయం #రైతు

fertilizer-availabilitypaddy
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Potash is an important nutrient for paddy crop growth, stem strength, water use, grain development, and crop health.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 74%Agriculture relevance: 98%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3044ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:24
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 22292bd4 · raw item 01e8386c · origin live

YouTubeAIR News HyderabadMedia organisation98%26 Aug, 19:13 IST
Medchal–Malkajgiri · Balanagar (95% conf.)Telugu / Englishstance: neutral32 views · 0 comments

తెలంగాణలోని 22 జిల్లాలకు 'ఫెర్టిలైజర్‌ సేల్స్‌' విధానం | Fertilizer Sales App | Medchal

Original — Telugu / English

మేడ్చల్–మల్కాజిగిరి జిల్లాలో ప్రయోగాత్మకంగా కేంద్ర ప్రభుత్వ ‘ఫ్రేమ్‌వర్క్‌ ఫర్‌ ఫెర్టిలైజర్‌ సేల్స్‌’ విధానాన్ని తెలంగాణలోని 22 జిల్లాలకు విస్తరించారు. ఈ యాప్ పనితీరు, ప్రయోజనాలను మేడ్చల్–మల్కాజిగిరి జిల్లా ఎరువుల విభాగం నోడల్ అధికారి, బాలానగర్ మండల వ్యవసాయ అధికారి సాయి రమేష్ వివరించారు.

English · AI translation

The ‘Fertilizer Sales’ policy for 22 districts in Telangana | Fertilizer Sales App | Medchal The pilot implementation of the central government’s ‘Framework for Fertilizer Sales’ policy in Medchal-Malkajgiri district has been expanded to 22 districts in Telangana. Sai Ramesh, the nodal officer of the fertilizer department in Medchal-Malkajgiri district and the agricultural officer of Balanagar mandal, explained the app’s functioning and benefits.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The 'Fertilizer Sales' policy has been expanded in Telangana to 22 districts, after being piloted in Medchal-Malkajgiri district.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2118ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:36
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 9fce58c3 · raw item 50ae5c92 · origin live

YouTubeDD NEWS TelanganaMedia organisation99%23 Aug, 16:59 IST
Karimnagar (98% conf.)Telugu / Englishstance: neutral812 views · 3 likes · 0 comments

Karimnagar Implements FFS App for Scientific Fertilizer Distribution and Soil Health Preservation

Original — Telugu / English

రైతుల సంక్షేమం, నేల ఆరోగ్యాన్ని కాపాడే లక్ష్యంతో కేంద్ర ప్రభుత్వం సరికొత్త డిజిటల్ విధానాన్ని అందుబాటులోకి తెచ్చింది. భూమి విస్తీర్ణం, సాగు చేసే పంటల ఆధారంగా అవసరమైన మోతాదులోనే ఎరువులను కొనుగోలు చేసేలా 'ఫ్రేమ్‌వర్క్ ఫర్ ఫెర్టిలైజర్స్ సేల్' మొబైల్ యాప్‌ను ప్రవేశపెట్టింది. Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms:

Show full source text as published

Karimnagar Implements FFS App for Scientific Fertilizer Distribution and Soil Health Preservation రైతుల సంక్షేమం, నేల ఆరోగ్యాన్ని కాపాడే లక్ష్యంతో కేంద్ర ప్రభుత్వం సరికొత్త డిజిటల్ విధానాన్ని అందుబాటులోకి తెచ్చింది. భూమి విస్తీర్ణం, సాగు చేసే పంటల ఆధారంగా అవసరమైన మోతాదులోనే ఎరువులను కొనుగోలు చేసేలా 'ఫ్రేమ్‌వర్క్ ఫర్ ఫెర్టిలైజర్స్ సేల్' మొబైల్ యాప్‌ను ప్రవేశపెట్టింది. Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms: YouTube: https://www.youtube.com/@ddnewstelangana Instagram: https://www.instagram.com/ddnewstelangana Twitter (X): https://x.com/ddyadagirinews Facebook: https://www.facebook.com/DDNewsHyderabad #DDNewsTelangana #TelanganaUpdates #HyderabadNews #LatestNews #PublicServiceBroadcasting #TeluguNews

English · AI translation

Karimnagar Implements FFS App for Scientific Fertilizer Distribution and Soil Health Preservation With the goal of protecting farmers' welfare and soil health, the central government has brought a new digital system into use. It has introduced the 'Framework for Fertilizers Sale' mobile app so that fertilizers can be purchased in the required quantities based on land area and the crops being cultivated. Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms:

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The Framework for Fertilizers Sale (FFS) mobile app has been introduced to enable fertilizer purchases based on land area and crops grown.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 98%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2021ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:28
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 4c69de6a · raw item 5f600092 · origin live

YouTubeETV AnnadataMedia organisation92%23 Aug, 14:00 IST
District not evidencedTelugustance: neutral2,660 views · 20 likes

#shorts - అన్నదాత@30 | టిష్యూకల్చర్ అరటిలో అధిక దిగుబడికి ఎరువులివే | ETV

Original — Telugu

#shorts - అన్నదాత@30 | టిష్యూకల్చర్ అరటిలో అధిక దిగుబడికి ఎరువులివే | ETV

Show full source text as published

#shorts - అన్నదాత@30 | టిష్యూకల్చర్ అరటిలో అధిక దిగుబడికి ఎరువులివే | ETV #annadata #etvshow #farming #farms #agriculture #cultivation #poultryfarming #aquaculture #fishfarming #horticulture #climatechange #agriculturetechnology#annadataetv #annadatatoday #annadataetv #annadatatoday 📺 Your favorite ETV shows are now just a tap away! Watch your favorite serials, reality shows, comedy, movies, news, originals, and more—anytime, anywhere with the ETV Win app. Download ETV Win App: https://f66tr.app.goo.gl/apps Visit our website: https://www.etv.co.in 💙 Follow the ETV family across YouTube, Instagram, Facebook, and X for exclusive updates, promos, behind-the-scenes content, and much more. ETV Telugu: https://www.youtube.com/@etvteluguindia https://www.instagram.com/etvtelugu2708 https://www.facebook.com/etvteluguindia https://x.com/etvteluguindia ETV Plus : https://www.youtube.com/@etvplusindia https://www.instagram.com/etvplusindia https://www.facebook.com/ETVPlusIndia https://x.com/etvplusindia ETV Cinema : https://www.youtube.com/@ETVCinema https://www.instagram.com/etv.cinema https://www.facebook.com/EtvCinemaIndia ETV Andhra Pradesh : https://www.youtube.com/@ETVAndhraPradesh https://www.instagram.com/etvandhrapradesh https://www.facebook.com/ETVAndhraPradesh https://x.com/etvandhraprades ETV Telangana : https://www.youtube.com/@etvtelangana https://www.instagram.com/etvtelangana https://www.facebook.com/ETVTelangana https://x.com/etvtelangana ETV Win : https://www.youtube.com/@EtvwinOriginals https://www.instagram.com/etvwin https://www.facebook.com/etvwin https://x.com/etvwin ETV Abhiruchi : https://www.youtube.com/@etvabhiruchi https://www.instagram.com/etvabhiruchi2015 https://www.facebook.com/ETVAbhiruchi ETV Life Spiritual : https://www.youtube.com/@etvlifespiritual https://www.instagram.com/etv_life_spiritual https://www.facebook.com/ETVLifeIndia ETV Dhee : https://www.youtube.com/@ETVDhee https://www.instagram.com/etv_dheeofficial https://www.facebook.com/ETVFunnyVideos ETV Comedy Junction : https://www.youtube.com/@etvcomedyjunction https://www.instagram.com/etvbalbharat https://www.facebook.com/etvbalbharat ETV Promos : https://www.youtube.com/@ETVPromos https://www.instagram.com/etvpromo https://www.facebook.com/etvpromos ETV Events : https://www.youtube.com/@etvteluguevents https://www.instagram.com/etvevents https://www.facebook.com/ETVPLUSPataas ETV Bal Bharat : https://www.youtube.com/@etvbalbharat https://www.instagram.com/etvbalbharat https://www.facebook.com/etvbalbharat ETV Jabardasth : https://www.youtube.com/@ETVJabardasth ETV Life : https://www.youtube.com/@etvlifeindia ETV Annadata : https://www.youtube.com/@ETVAnnadata ETV Life : https://www.youtube.com/@etvlifeindia ETV Originals : https://www.youtube.com/@etvoriginals ETV Dance Studio : https://www.youtube.com/@etvdancestudio ETV Folk Studio : https://www.youtube.com/@etvfolkstudio ETV Shorts India : https://www.youtube.com/@etvshortsindia ETV Chit Chat : https://www.youtube.com/@ETVChitChat

English · AI translation

#shorts - Annadata@30 | These are the fertilizers for higher yield in tissue-culture banana | ETV

fertilizer-availabilityhorticulture
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content says these are the fertilizers for higher yield in tissue-culture banana.” · confidence 83%

Sentiment: neutralStance toward government: neutralTelangana relevance: 60%Agriculture relevance: 90%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1691ms)

Processing trail
  1. NORMALIZED · 25 Aug, 09:42
  2. RELEVANCE_ACCEPTED · 25 Aug, 09:48
  3. ENRICHED · 25 Aug, 10:07
  4. DEDUPED · 25 Aug, 10:17
  5. NARRATIVE_ASSIGNED · 25 Aug, 10:17
  6. ENRICHED · 8 Sept, 01:28
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 903cea60 · raw item f1d7c864 · origin live

XA.RAVINDER RAJU@ravinder_aCitizen72%23 Aug, 05:10 IST
District not evidencedTelugustance: neutral4 views · 0 likes · 0 reposts · 0 comments
Original — Telugu

ఉత్తర తెలంగాణ లో భారీ వర్షం ప్రత్తికీ యూరియా +పొటాష్ 50 kg జింక్ 10 kg బోరన్ 1 కిలో భూమిలో వెయ్యాలి ప్రత్తిపైన 25gml హ్యూమిక్ / సాగరిక/ జింక్ బోరన్ సాఫ్ క్లోరిపైరిఫాస్ 2 ఆస్ప్రిన్ గోలి యూరియా +పొటాష్ 250g ట్యాంక్ లో 20 రోజులకోసారి పిచికారి చెయ్యాలి

English · AI translation

In North Telangana, after heavy rain, for cotton, 50 kg urea + potash, 10 kg zinc, and 1 kg boron should be applied in the soil. On cotton, spray every 20 days in a tank with 25 gml humic / saagari / zinc boron, saff, chlorpyrifos, 2 aspirin tablets, and 250 g urea + potash.

rainfallfertilizer-availabilitycrop-damagefloodingcotton
Open original source ↗
AI interpretation & provenance
Extracted claim

“In North Telangana, after heavy rain, cotton should be given 50 kg urea + potash, 10 kg zinc, and 1 kg boron in the soil.” · confidence 74%

Sentiment: neutralStance toward government: neutralTelangana relevance: 80%Agriculture relevance: 100%Classification confidence: 82%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2180ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:20
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:42
  3. ENRICHED · 30 Aug, 00:22
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:27
  6. NARRATIVE_ASSIGNED · 30 Aug, 02:28
  7. ENRICHED · 8 Sept, 01:35
  8. DEDUPED · 8 Sept, 02:09
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  10. NARRATIVE_ASSIGNED · 8 Sept, 02:13
  11. NARRATIVE_ASSIGNED · 8 Sept, 02:15
  12. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  13. NARRATIVE_ASSIGNED · 14 Sept, 14:18
  14. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  15. NARRATIVE_ASSIGNED · 14 Sept, 16:40
  16. NARRATIVE_ASSIGNED · 14 Sept, 16:43
  17. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  18. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  19. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  20. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  21. NARRATIVE_ASSIGNED · 15 Sept, 02:27
  22. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  23. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  24. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  25. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  26. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  27. NARRATIVE_ASSIGNED · 15 Sept, 19:53
  28. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  29. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  30. NARRATIVE_ASSIGNED · 16 Sept, 09:43
  31. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  32. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  33. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  34. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  35. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  36. NARRATIVE_ASSIGNED · 17 Sept, 20:59
  37. NARRATIVE_ASSIGNED · 17 Sept, 21:01
  38. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  39. NARRATIVE_ASSIGNED · 18 Sept, 04:06
  40. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  41. NARRATIVE_ASSIGNED · 20 Sept, 11:04
  42. NARRATIVE_ASSIGNED · 20 Sept, 19:45
  43. NARRATIVE_ASSIGNED · 20 Sept, 23:12
  44. NARRATIVE_ASSIGNED · 21 Sept, 01:27
  45. NARRATIVE_ASSIGNED · 21 Sept, 11:15
  46. NARRATIVE_ASSIGNED · 21 Sept, 22:40
  47. NARRATIVE_ASSIGNED · 22 Sept, 05:31

mention 36282f27 · raw item b473e045 · origin live

XA.RAVINDER RAJU@ravinder_aCitizen72%23 Aug, 04:57 IST
District not evidencedTelugustance: neutral3 views · 0 likes · 0 reposts · 0 comments
Original — Telugu

ఉత్తర తెలంగాణ లో భారీ వర్షం ప్రత్తికీ యూరియా +పొటాష్ 50 జింక్ 10 బోరన్ 1 కిలోలు భూమిలో వెయ్యాలి

English · AI translation

In North Telangana, after heavy rain, for cotton, 50 kg urea + potash, 10 kg zinc, and 1 kg boron should be applied into the soil.

rainfallfertilizer-availabilityinput-costrainfall-deficitcotton
Open original source ↗
AI interpretation & provenance
Extracted claim

“In North Telangana, after heavy rain, for cotton 50 kg urea + potash, 10 kg zinc, and 1 kg boron should be applied to the soil.” · confidence 91%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 98%Classification confidence: 83%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1701ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:20
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:42
  3. ENRICHED · 30 Aug, 00:23
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:25
  6. NARRATIVE_ASSIGNED · 30 Aug, 02:27
  7. ENRICHED · 8 Sept, 01:38
  8. DEDUPED · 8 Sept, 02:09
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  10. NARRATIVE_ASSIGNED · 8 Sept, 02:13
  11. NARRATIVE_ASSIGNED · 8 Sept, 02:20
  12. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  13. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  14. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  15. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  16. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  17. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  18. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  19. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  20. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  21. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  22. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  23. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  24. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  25. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention d16f8ddc · raw item 9498b13e · origin live

YouTubeV6 News TeluguMedia organisation99%22 Aug, 20:10 IST
Peddapalli (58% conf.)Telugu / Englishstance: neutral389 views · 3 likes · 0 comments

Tummala Writes to Union Minister Over Ramagundam Fertilizers Plant Shutdown | V6 News

Original — Telugu / English

Watch Teenmaar Full Episode E 20 పెట్రోలే మంచిది ఎంపీ గారి ప్రయోగాలు 230కే సిమెంట్ బస్తా సర్కార్ బడికే మంత్రుల పిల్లలు తమిళ ఎమ్మెల్యేలకు పండుగ కొత్త కారు..2 లక్షల జీతం చెన్నూరులో చకచకా పనులు ప్రిన్స్ పల్ ను సంపిన పిల్లలు సైబర్ దొంగలు కోటి కొట్టేస్తే.. (క్యాష్...బాధితుడు...సైబర్ గ్యాంగ్...పోలీసులు) కరువు తప్పదా..? ఫ్లై ఓవర్ మీద గిదేం చెత్తా..? Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News"

Show full source text as published

Tummala Writes to Union Minister Over Ramagundam Fertilizers Plant Shutdown | V6 News Watch Teenmaar Full Episode https://youtu.be/08adphbOVZM E 20 పెట్రోలే మంచిది ఎంపీ గారి ప్రయోగాలు https://youtu.be/Em75lgdqTHM 230కే సిమెంట్ బస్తా https://youtu.be/9km1nJtDYUY సర్కార్ బడికే మంత్రుల పిల్లలు https://youtu.be/Z0exEfUxf3s తమిళ ఎమ్మెల్యేలకు పండుగ కొత్త కారు..2 లక్షల జీతం https://youtu.be/j3DrQ-xLQGM చెన్నూరులో చకచకా పనులు https://youtu.be/XlENAY58cik ప్రిన్స్ పల్ ను సంపిన పిల్లలు https://youtu.be/sybXk_Bs27I సైబర్ దొంగలు కోటి కొట్టేస్తే.. (క్యాష్...బాధితుడు...సైబర్ గ్యాంగ్...పోలీసులు) https://youtu.be/QHa0Ch8kbRM కరువు తప్పదా..? https://youtu.be/cRoNca17yoQ సినిమా టికెట్ https://youtu.be/309z00-i5_c ఫ్లై ఓవర్ మీద గిదేం చెత్తా..? https://youtu.be/N3zKyezOQEY Watch LIVE Stream : https://www.youtube.com/watch?v=nrb8P8shbDk ► Subscribe to V6 News : https://www.youtube.com/c/V6NewsTelugu ► Subscribe to V6 Life : https://www.youtube.com/c/V6Life ► Follow Us On Dailymotion : https://www.dailymotion.com/v6newstelugu ► Like us on Facebook : http://www.facebook.com/V6News.tv ► Follow us on Instagram : https://www.instagram.com/v6newstelugu/ ► Follow us on Twitter : https://twitter.com/V6News ► Visit Website : http://www.v6velugu.com/ ► Join Us On Telegram : https://t.me/V6NewsTelugu Watch V6 Programs Here ►Teenmaar : https://rb.gy/qn91pg ►Trending Videos : https://rb.gy/f6i0x2 ►Top News : https://rb.gy/wqjeun ►HD Playlist : https://rb.gy/veit87 ►Innerview : https://rb.gy/83izwa ►Medaram Jatara : https://rb.gy/mn4tu7 ►Chandravva : https://rb.gy/nja3cl ►Spotlight : https://rb.gy/4lfm9s ►Dhoom Thadaka : https://rb.gy/hvytxl ►V6 Songs : https://rb.gy/68n90s ►Life Mates : https://rb.gy/itvwfa News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News" #Ramagundam #RamagundamFertilizers#FertilizerPlant #TummalaNageswaraRao #V6News #V6 #V6Velugu #TelanganaNews #Telangana

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Tummala wrote to the Union Minister about the shutdown of the Ramagundam Fertilizers Plant.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 91%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1691ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:33
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 7e31ffef · raw item f14bdef5 · origin live

XA.RAVINDER RAJU@ravinder_aCitizen72%22 Aug, 19:17 IST
District not evidencedTelugustance: neutral3 views · 0 likes · 0 reposts · 0 comments
Original — Telugu

తూర్పు తెలంగాణ ప్రత్తి రైతులు యూరియా +పొటాష్ ఒక బస్తా జింక్ 10 బోరాక్స్ 5 కేజీల్లు వెయ్యాలి వచ్చేవారం వర్షమొస్తుంది

English · AI translation

Eastern Telangana cotton farmers should apply one bag of urea and potash, 10 kg of zinc, and 5 kg of borax. It will rain next week.

fertilizer-availabilityrainfallcotton
Open original source ↗
AI interpretation & provenance
Extracted claim

“Eastern Telangana cotton farmers should apply one bag of urea, potash, 10 kg zinc, and 5 kg borax, and it will rain next week.” · confidence 88%

Sentiment: neutralStance toward government: neutralTelangana relevance: 85%Agriculture relevance: 95%Classification confidence: 83%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1702ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:20
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:42
  3. ENRICHED · 30 Aug, 00:23
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:26
  6. NARRATIVE_ASSIGNED · 30 Aug, 02:27
  7. ENRICHED · 8 Sept, 01:35
  8. DEDUPED · 8 Sept, 02:09
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  10. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  11. NARRATIVE_ASSIGNED · 14 Sept, 14:08
  12. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  13. NARRATIVE_ASSIGNED · 14 Sept, 16:41
  14. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  15. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  16. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  17. NARRATIVE_ASSIGNED · 15 Sept, 02:27
  18. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  19. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  20. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  21. NARRATIVE_ASSIGNED · 15 Sept, 14:38
  22. NARRATIVE_ASSIGNED · 15 Sept, 19:53
  23. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  24. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  25. NARRATIVE_ASSIGNED · 17 Sept, 00:02
  26. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  27. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  28. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  29. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  30. NARRATIVE_ASSIGNED · 22 Sept, 09:14
  31. NARRATIVE_ASSIGNED · 22 Sept, 14:24
  32. NARRATIVE_ASSIGNED · 22 Sept, 19:37
  33. NARRATIVE_ASSIGNED · 23 Sept, 02:35
  34. NARRATIVE_ASSIGNED · 23 Sept, 07:30
  35. NARRATIVE_ASSIGNED · 23 Sept, 18:32

mention 2826615b · raw item dddcf933 · origin live

YouTubeAap Tak Urdu NewsMedia organisation92%21 Aug, 22:22 IST
Adilabad (98% conf.)Englishstance: neutral320 views · 9 likes · 2 comments

ADILABAD POLICE ARREST 5 IN FAKE FERTILIZER FRANCHISE CYBER FRAUD CASE; ₹3.5 CRORE FRAUD SUSPECTED.

Original — English

ADILABAD POLICE ARREST 5 IN FAKE FERTILIZER FRANCHISE CYBER FRAUD CASE; ₹3.5 CRORE FRAUD SUSPECTED.

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Adilabad police arrested five people in a fake fertilizer franchise cyber fraud case, and a ₹3.5 crore fraud is suspected.” · confidence 99%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 80%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1633ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:23
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 902b201e · raw item 25c0b7bf · origin live

YouTubeT-SAT NetworkMedia organisation98%21 Aug, 11:19 IST
District not evidencedTelugustance: neutral901 views · 5 likes · 0 comments

నత్రజని ఎరువులు ఉపయోగాలు ? | T-SAT

Original — Telugu

Our Channels Links 🎬 🎥 🔴 ▶ 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : ఏ ప్రభుత్వ ఉద్యోగానికి సిద్ధమౌతున్నా... తాజా సమాచారం కోసం లింక్ క్లిక్ చేసి గూగుల్ ఫామ్ లో నమోదు చేసుకోండి : 𝗧𝗼 𝗴𝗲𝘁 𝗹𝗮𝘁𝗲𝘀𝘁 𝘂𝗽𝗱𝗮𝘁𝗲𝘀 𝗳𝗼𝗿 𝗖𝗼𝗺𝗽𝗲𝘁𝗶𝘁𝗶𝘃𝗲 𝗘𝘅𝗮𝗺𝘀 𝗳𝗿𝗼𝗺 𝗧-𝗦𝗔𝗧 𝗘𝗻𝗿𝗼𝗹𝗹 𝘁𝗵𝗲 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : Please do Not issue a Copyright Strike against the Channel it affects our Channel and its non-profit organization. Previous work if Uploaded Song that is yours and you want it removed then Please Contact and We will Remove the Whole Video in less than 12 hours 📞Phone No :-7337558051, Email : - feedback-softnet@telangana.gov.in. T-SAT Network Digital Classes are Now Available on Following Platforms: 1. For Android Users: Play Store 2. For Apple Users: AppStore ---Watch on -Jio TV - Educational Genre & JIO TV+ -T-fiber HATHWAY 444 & 445 BRIGHTWAY 49 & 50 SITI VISION 39 & 40 SSC BARATHI 71 &72 RVR 133 & 134 SITI CABLE 38 & 39 BCN 851 & 852 D2H 2483 & 2484 GTPL 93 & 94

Show full source text as published

నత్రజని ఎరువులు ఉపయోగాలు ? | T-SAT నత్రజని ఎరువులు ఉపయోగాలు ? | T-SAT #TSAT #TSAThastags #నత్రజనిఎరువులు #ఎరువులు #వ్యవసాయం #రైతులు #పంటలపెరుగుదల #సస్యపోషణ #పంటలదిగుబడి #వ్యవసాయసలహాలు #Agriculture #NitrogenFertilizers #Farmers #CropGrowth #TSA​TNetwork ---------------------------------------------------------- Our Channels Links 🎬 🎥 🔴 ▶ Please Subscribe & Get Updates: • T-SAT Network - https://www.youtube.com/TSATNetwork • T-SAT Agri - https://www.youtube.com/@TSATAgri • T-SAT Culture - https://www.youtube.com/@TSATCulture • T-SAT Health - https://www.youtube.com/@TSATHealth • T-SAT Nipuna - https://www.youtube.com/@TSATNipuna • T-SAT Vidya - https://www.youtube.com/@TSATVIDYA -------------------------------------------------------- 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : ఏ ప్రభుత్వ ఉద్యోగానికి సిద్ధమౌతున్నా... తాజా సమాచారం కోసం లింక్ క్లిక్ చేసి గూగుల్ ఫామ్ లో నమోదు చేసుకోండి : https://tinyurl.com/tsattv 𝗧𝗼 𝗴𝗲𝘁 𝗹𝗮𝘁𝗲𝘀𝘁 𝘂𝗽𝗱𝗮𝘁𝗲𝘀 𝗳𝗼𝗿 𝗖𝗼𝗺𝗽𝗲𝘁𝗶𝘁𝗶𝘃𝗲 𝗘𝘅𝗮𝗺𝘀 𝗳𝗿𝗼𝗺 𝗧-𝗦𝗔𝗧 𝗘𝗻𝗿𝗼𝗹𝗹 𝘁𝗵𝗲 𝗧𝗦𝗔𝗧 𝗚𝗼𝗼𝗴𝗹𝗲 𝗳𝗼𝗿𝗺 𝗹𝗶𝗻𝗸 : https://tinyurl.com/tsattv Please do Not issue a Copyright Strike against the Channel it affects our Channel and its non-profit organization. Previous work if Uploaded Song that is yours and you want it removed then Please Contact and We will Remove the Whole Video in less than 12 hours 📞Phone No :-7337558051, Email : - feedback-softnet@telangana.gov.in. T-SAT Network Digital Classes are Now Available on Following Platforms: 👉Subscribe us on: https://www.youtube.com/tsatnetwork 👉Like us on: https://www.facebook.com/tsatnetwork 👉Follow us on: https://twitter.com/tsatnetwork 👉Follow us on: https://instagram.com/tsatnetwork 👉To Register & Watch on: https://www.tsat.tv 👉Install T-SAT App: 1. For Android Users: Play Store 2. For Apple Users: AppStore ---Watch on -Jio TV - Educational Genre & JIO TV+ -T-fiber 📡 📺𝗪𝗮𝘁𝗰𝗵 𝗧-𝗦𝗔𝗧 𝗩𝗜𝗗𝗬𝗔 & 𝗡𝗜𝗣𝗨𝗡𝗔 𝗖𝗵𝗮𝗻𝗻𝗲𝗹𝘀 𝗶𝗻 𝗕𝗲𝗹𝗼𝘄 𝗠𝗦𝗢 / 𝗖𝗮𝗯𝗹𝗲 𝗧𝗲𝗹𝗲𝘃𝗶𝘀𝗶𝗼𝗻 𝗡𝗲𝘁𝘄𝗼𝗿𝗸𝘀 HATHWAY 444 & 445 BRIGHTWAY 49 & 50 SITI VISION 39 & 40 SSC BARATHI 71 &72 RVR 133 & 134 SITI CABLE 38 & 39 BCN 851 & 852 D2H 2483 & 2484 GTPL 93 & 94

English · AI translation

What are the uses of nitrogen fertilizers? | T-SAT Our Channels Links 🎬 🎥 🔴 ▶ TSAT Google form link: Even if you are preparing for any government job... Click the link for the latest information and register in the Google Form: To get latest updates for Competitive Exams from T-SAT Enroll the TSAT Google form link: Please do Not issue a Copyright Strike against the Channel it affects our Channel and its non-profit organization. Previous work if Uploaded Song that is yours and you want it removed then Please Contact and We will Remove the Whole Video in less than 12 hours Phone No :-7337558051, Email :- feedback-softnet@telangana.gov.in. T-SAT Network Digital Classes are Now Available on Following Platforms: 1. For Android Users: Play Store 2. For Apple Users: AppStore Watch on -Jio TV - Educational Genre & JIO TV+ -T-fiber HATHWAY 444 & 445 BRIGHTWAY 49 & 50 SITI VISION 39 & 40 SSC BARATHI 71 &72 RVR 133 & 134 SITI CABLE 38 & 39 BCN 851 & 852 D2H 2483 & 2484 GTPL 93 & 94 Depending on rainfall, at least 60 to 70% of agriculture in Telangana depends on this rainfall. In such a case, if we want to increase nutrient efficiency without reducing yields, if we follow rainfall-based nitrogen scheduling, then whenever a prediction comes that rain will come, if we apply nitrogen the day before and cover the soil, when moisture comes in the form of rain, the nitrogen will immediately reach the root system and the chance of it directly reaching the plant will improve.

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“In Telangana, 60–70% of agriculture depends on rainfall.” · confidence 88%

Sentiment: neutralStance toward government: neutralTelangana relevance: 96%Agriculture relevance: 99%Classification confidence: 89%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3013ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 81790424 · raw item c46d8ea7 · origin live

Near-duplicateYouTubeT-SAT Agri21 Aug, 11:19 ISTnot counted toward volume

నత్రజని ఎరువులు ఉపయోగాలు ? | T-SAT

YouTube(TVG MINI VLOG'S)Creator71%19 Aug, 17:03 IST
Nalgonda (62% conf.)Telugu / Englishstance: neutral1,483 views · 33 likes · 2 comments

the fertilizer day #viral#yt#shorts#1m#100k#hyd#export#nalgonda#farmer#fishing#shorts#supporting

Original — Telugu / English

ఫర్ మోర్ అప్డేట్ సబ్స్క్రయిబ్ అవర్ ఛానల్ నౌ థాంక్స్ ఫర్ వాచింగ్ లవ్ యు ఆన్

English · AI translation

For more updates, subscribe to our channel now. Thanks for watching. Love you all.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions "the fertilizer day" and includes the hashtag #nalgonda.” · confidence 89%

Sentiment: neutralStance toward government: neutralTelangana relevance: 70%Agriculture relevance: 90%Classification confidence: 56%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1898ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:58
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 1dfb595b · raw item fd5beefb · origin live

YouTubeJai Ho KisanMedia organisation89%17 Aug, 10:27 IST
District not evidencedTelugustance: neutral1,03,758 views · 80 likes · 0 comments

ఫార్మర్ రిజిస్ట్రీలో నమోదు చేసుకుంటేనే ఎరువులు #tsfarmers #jaihokisan #farming

Original — Telugu

ఫార్మర్ రిజిస్ట్రీలో నమోదు చేసుకుంటేనే ఎరువులు రైతులకు ఎరువుల సరఫరాలో కేంద్రం కీలక మార్పు తీసుకొచ్చింది. ఫార్మర్ రిజిస్ట్రీలో నమోదు చేసుకున్న రైతులు మాత్రమే ఎరువుల కోసం బుకింగ్ చేసుకునేలా నిబంధనలు అమలు చేయనుంది. ఇందుకోసం ఫ్రేమ్‌వర్క్ ఫర్ ఫెర్టిలైజర్ సేల్ (FFS) యాప్‌ను అందుబాటులోకి తెచ్చింది. తెలంగాణలో ఇప్పటికే ఈ విధానం అమల్లో ఉండగా, రాబోయే రోజుల్లో ప్రభుత్వ పథకాల లబ్ధి పొందాలంటే ఈ రిజిస్ట్రేషన్ తప్పనిసరి అవుతుందని వ్యవసాయ అధికారులు స్పష్టం చేస్తున్నారు.

Show full source text as published

ఫార్మర్ రిజిస్ట్రీలో నమోదు చేసుకుంటేనే ఎరువులు #tsfarmers #jaihokisan #farming ఫార్మర్ రిజిస్ట్రీలో నమోదు చేసుకుంటేనే ఎరువులు #tsfarmers #jaihokisan #farming రైతులకు ఎరువుల సరఫరాలో కేంద్రం కీలక మార్పు తీసుకొచ్చింది. ఫార్మర్ రిజిస్ట్రీలో నమోదు చేసుకున్న రైతులు మాత్రమే ఎరువుల కోసం బుకింగ్ చేసుకునేలా నిబంధనలు అమలు చేయనుంది. ఇందుకోసం ఫ్రేమ్‌వర్క్ ఫర్ ఫెర్టిలైజర్ సేల్ (FFS) యాప్‌ను అందుబాటులోకి తెచ్చింది. తెలంగాణలో ఇప్పటికే ఈ విధానం అమల్లో ఉండగా, రాబోయే రోజుల్లో ప్రభుత్వ పథకాల లబ్ధి పొందాలంటే ఈ రిజిస్ట్రేషన్ తప్పనిసరి అవుతుందని వ్యవసాయ అధికారులు స్పష్టం చేస్తున్నారు. Visit our Website - https://jaihokisan.in/ Click Here to follow on Facebook for more Agriculture updates - https://www.facebook.com/Jaihokisan Click Here to follow on Instagram for more Agriculture updates - https://www.instagram.com/jaiho.kisan/ Click Here to follow us on Twitter for Agriculture updates - https://twitter.com/jaiho_kisan #jaihokisan #jaihokisanapp #cropadvisory #agriequipment #farmingapp #seeds #fertilizers #marketrates #jaihorytex #jaihoranger #jaihonavarathna #jaihokohinoor #jaihomonk #jaihovishwamithra #jaihoagent #farmerregistry #fertilizer #fertilizerbooking #ffsapp #farmerid #fertilizerupdate #farmers #farmernews #agriculture #agricultureindia #fertilizernews #telanganafarmers #teluguagriculture #telugunews #agrinews #indianfarmers #farming #jaihokisan Farmer Registry, Farmer Registry latest update, fertilizer booking, fertilizer booking app, FFS app, Framework for Fertilizer Sale, FFS fertilizer app, fertilizer new rules, fertilizer latest news, fertilizer booking farmers, Farmer ID, farmer registry Telangana, fertilizer rules Telangana, Telangana farmers, fertilizer subsidy, fertilizer distribution, fertilizer shortage, farmer news Telugu, agriculture news Telugu, Telugu agriculture, fertilizer update Telugu, Indian farmers, government schemes farmers, agriculture latest news, Jai Ho Kisan

English · AI translation

If you register in the Farmer Registry, only then will you get fertilizers. The central government has brought a key change in fertilizer supply to farmers. It will implement rules so that only farmers registered in the Farmer Registry can book fertilizers. For this, it has made the Framework for Fertilizer Sale (FFS) app available. This system is already in place in Telangana, and agriculture officials have clarified that in the coming days, registration will be mandatory to receive the benefits of government schemes.

fertilizer-availabilityfarmer-support-schemes
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Only farmers registered in the Farmer Registry will be able to book fertilizers under the new system.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 100%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2137ms)

Processing trail
  1. NORMALIZED · 8 Sept, 11:20
  2. RELEVANCE_ACCEPTED · 8 Sept, 11:25
  3. ENRICHED · 8 Sept, 11:31
  4. DEDUPED · 8 Sept, 11:35
  5. NARRATIVE_ASSIGNED · 8 Sept, 11:35
  6. NARRATIVE_ASSIGNED · 8 Sept, 11:36
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:20
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:46
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 15 Sept, 14:41
  17. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  18. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  19. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  20. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  21. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  22. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  23. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  24. NARRATIVE_ASSIGNED · 23 Sept, 02:43
  25. NARRATIVE_ASSIGNED · 23 Sept, 13:03

mention b41a36c9 · raw item 0c3fe491 · origin live

Public webSrinivas Reddy KumbhamPolitician86%17 Aug, 09:16 IST
District not evidencedEnglishstance: supportive

Rythu Bharosa is empowering Telangana's farmers with timely financial support to invest in seeds, fertilisers and other essential farming ne

Original — English

Rythu Bharosa is empowering Telangana's farmers with timely financial support to invest in seeds, fertilisers and other essential farming needs. Together, we are building a stronger and more prosperous agricultural future for every farmer. #RythuBharosa #FarmersFirst #Telangana #FarmerWelfare #Agriculture #KumbhamSrinivasReddy #TPCC @vegeswarapuram1 @tgmeeseva @vcare.onlineservices @meeseva._services_.12 @telanganafarmers @telanganafarmersofficial

Show full source text as published

Rythu Bharosa is empowering Telangana's farmers with timely financial support to invest in seeds, fertilisers and other essential farming ne Rythu Bharosa is empowering Telangana's farmers with timely financial support to invest in seeds, fertilisers and other essential farming needs. Together, we are building a stronger and more prosperous agricultural future for every farmer. Know More: https://rythubharosa.telangana.gov.in #RythuBharosa #FarmersFirst #Telangana #FarmerWelfare #Agriculture #KumbhamSrinivasReddy #TPCC @vegeswarapuram1 @tgmeeseva @vcare.onlineservices @meeseva._services_.12 @telanganafarmers @telanganafarmersofficial

farmer-support-schemesseedsfertilizer-availabilityrythu-bharosa
Open original source ↗
AI interpretation & provenance
Extracted claim

“Rythu Bharosa is providing timely financial support to Telangana farmers for seeds, fertilisers, and other essential farming needs.” · confidence 95%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1598ms)

Processing trail
  1. NORMALIZED · 29 Aug, 15:26
  2. RELEVANCE_ACCEPTED · 29 Aug, 15:27
  3. ENRICHED · 29 Aug, 15:31
  4. DEDUPED · 29 Aug, 15:38
  5. NARRATIVE_ASSIGNED · 29 Aug, 15:38
  6. ENRICHED · 8 Sept, 01:31
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  10. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  11. NARRATIVE_ASSIGNED · 14 Sept, 14:20
  12. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  13. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  14. NARRATIVE_ASSIGNED · 14 Sept, 16:46
  15. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  16. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  17. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  18. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  19. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  20. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  21. NARRATIVE_ASSIGNED · 15 Sept, 14:41
  22. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  23. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  24. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  25. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  26. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  27. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  28. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  29. NARRATIVE_ASSIGNED · 23 Sept, 02:43
  30. NARRATIVE_ASSIGNED · 23 Sept, 13:03

mention 34b571ce · raw item 7506fc33 · origin live

YouTubeAR GROUP INDIADealer92%16 Aug, 14:45 IST
Warangal (91% conf.)Englishstance: neutral215 views · 7 likes · 0 comments

KEROMIN || FARMOVA GLOBAL || AZAZ FERTILIZERS MONDRAI WARANGAL || RIYAZ 7799527693

Original — English

PRIME ORGANIC FERTILIZER FROM FARMOVA GLOBAL “KEROMIN” || COTTON || PADDY || CHILLI || MAIZE || ALL VEGITABLE CROPS || AUTHORISED DISTRIBUTOR || AZAZ FERTILIZERS MONDRAI WARANGAL || RIYAZ 7799527693

fertilizer-availabilitycottonpaddychillimaizehorticulture
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The text says that Azaz Fertilizers in Mondrai, Warangal is an authorised distributor of Farmova Global's organic fertilizer 'Keromin'.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 80%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2167ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:26
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention c61167f5 · raw item cdb95cb6 · origin live

YouTubeYK LaboratoriesFarmer83%15 Aug, 10:14 IST
Mahabubnagar (92% conf.)Telugu / Englishstance: neutral17,201 views · 206 likes · 2 comments

మహబూబ్ నగర్ మొక్క జొన్న రైతు - గుళికలు వేయలేదు ఫెర్టిలైజర్స్ ఇవ్వలేదు,రూటెక్స్1 ltr మయూర1Ltr #Mayura

Original — Telugu / English

A maize farmer from Mahabubnagar achieved excellent crop growth without applying granules or chemical fertilizers! 🌽🔥 The farmer used only: The field shows strong root development, healthy plant growth, excellent crop vigour and uniform Army worm controlled with Mayura. This practical field result demonstrates the power of the YK Laboratories maize combination.

Show full source text as published

మహబూబ్ నగర్ మొక్క జొన్న రైతు - గుళికలు వేయలేదు ఫెర్టిలైజర్స్ ఇవ్వలేదు,రూటెక్స్1 ltr మయూర1Ltr #Mayura A maize farmer from Mahabubnagar achieved excellent crop growth without applying granules or chemical fertilizers! 🌽🔥 The farmer used only: ✅ FOST Rootex – 1 Litre ✅ YK Mayura – 1 Litre The field shows strong root development, healthy plant growth, excellent crop vigour and uniform Army worm controlled with Mayura. This practical field result demonstrates the power of the YK Laboratories maize combination. 🌽 Strong Roots • Healthy Growth • Better Crop Potential 🌿 YK Laboratories – Farmer-Focused Research & Innovation #Mayura #FOSTRootex #Maize #MaizeFarming #CornFarming #Mahabubnagar #MaizeFarmer #StrongRoots #HealthyCrop #CropGrowth #CropNutrition #FertilizerFreeTrial #FieldResults #YKLaboratories #IndianFarmers #AgricultureIndia #TelanganaFarmers #మొక్కజొన్న #మహబూబ్‌నగర్ #వ్యవసాయం కత్తెర పురుగు లద్దె పురుగు

English · AI translation

Mahabubnagar maize farmer - did not apply granules, did not give fertilizers, Rootex 1 ltr, Mayura 1 ltr #Mayura A maize farmer from Mahabubnagar achieved excellent crop growth without applying granules or chemical fertilizers! 🌽🔥 The farmer used only: The field shows strong root development, healthy plant growth, excellent crop vigour and uniform armyworm control with Mayura. This practical field result demonstrates the power of the YK Laboratories maize combination.

fertilizer-availabilitypest-outbreakmaize
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A maize farmer from Mahabubnagar achieved excellent crop growth without applying granules or chemical fertilizers, and armyworm was controlled with Mayura.” · confidence 90%

Sentiment: positiveStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 100%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2399ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:30
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:31
  3. ENRICHED · 10 Sept, 15:33
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 10 Sept, 15:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  15. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  16. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  17. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  18. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 15ab88e2 · raw item d5df760f · origin live

YouTubeDEVI IPM Technologies– KHAMMAMDealer78%12 Aug, 17:12 IST
Khammam (98% conf.)Telugustance: supportive1,626 views · 22 likes · 2 comments

🌱 రైతులకు నమ్మకమైన వ్యవసాయ భాగస్వామి | DEVI IPM Fertilizers, Khammam. || #DEVIIPM #crop #care

Original — Telugu

రైతుల అవసరాలను దృష్టిలో పెట్టుకుని **విత్తనాలు, ఎరువులు మరియు పంటల సంరక్షణకు అవసరమైన వ్యవసాయ ఉత్పత్తులు** అందిస్తున్న **DEVI IPM Fertilizers & Seeds**. ఈ వీడియోలో రైతుల పంట అవసరాలు, వ్యవసాయ ఉత్పత్తుల లభ్యత మరియు **DEVI IPM** అందిస్తున్న సేవలను చూపిస్తున్నాము. 🚜🌾 9640665556 9640665500

Show full source text as published

🌱 రైతులకు నమ్మకమైన వ్యవసాయ భాగస్వామి | DEVI IPM Fertilizers, Khammam. || #DEVIIPM #crop #care 🌱 **DEVI IPM FERTILIZERS & SEEDS – KHAMMAM** రైతుల అవసరాలను దృష్టిలో పెట్టుకుని **విత్తనాలు, ఎరువులు మరియు పంటల సంరక్షణకు అవసరమైన వ్యవసాయ ఉత్పత్తులు** అందిస్తున్న **DEVI IPM Fertilizers & Seeds**. ఈ వీడియోలో రైతుల పంట అవసరాలు, వ్యవసాయ ఉత్పత్తుల లభ్యత మరియు **DEVI IPM** అందిస్తున్న సేవలను చూపిస్తున్నాము. 🚜🌾 📍 **DEVI IPM FERTILIZERS & SEEDS – KHAMMAM** 📞 **Contact:** 9640665556 9640665500 👉 వ్యవసాయ సమాచారం, పంటల సంరక్షణ సూచనలు మరియు DEVI IPM ఉత్పత్తుల సమాచారం కోసం మా YouTube Channel ను **Subscribe** చేయండి. 🔔 **Subscribe | Like | Share | Comment** #DeviIPM #DeviIPMKhammam #FertilizersAndSeeds #Khammam #Agriculture #Farmers #TelanganaFarmers #AgricultureTelangana #CropProtection #Seeds #Fertilizers #రైతులు #వ్యవసాయం #ఖమ్మం

English · AI translation

A trusted agricultural partner for farmers | DEVI IPM Fertilizers, Khammam. || #DEVIIPM #crop #care DEVI IPM Fertilizers & Seeds provides agricultural products needed for seeds, fertilizers, and crop care, keeping farmers’ needs in mind. In this video, we are showing farmers’ crop needs, the availability of agricultural products, and the services being provided by DEVI IPM. 🚜🌾 9640665556 9640665500

seedsfertilizer-availabilityfarm-mechanisationseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“DEVI IPM Fertilizers & Seeds in Khammam provides seeds, fertilizers, and agricultural products for crop care.” · confidence 94%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 95%Agriculture relevance: 95%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3589ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:34
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  7. NARRATIVE_ASSIGNED · 10 Sept, 15:40
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  17. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  18. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  19. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  20. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  21. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 21d89ca5 · raw item 2bfad8e0 · origin live

YouTubeABN Telugu Media organisation98%12 Aug, 13:20 IST
Vikarabad (98% conf.)Telugu / Englishstance: neutral164 views · 1 likes · 0 comments

వికారాబాద్‌ జిల్లాలో నకిలీ డీఏపీ కలకలం..| Fake DAP Fertilizer Scam Exposed in Parigi | ABN Telugu

Original — Telugu / English

వికారాబాద్‌ జిల్లాలో నకిలీ డీఏపీ కలకలం.. ఆందోళనలో రైతులు | Fake DAP Fertilizer Scam Exposed in Parigi | ABN Telugu వికారాబాద్ జిల్లా పరిగి నియోజకవర్గంలో నకిలీ డీఏపీ ఎరువును రైతులు పట్టుకున్నారు. వాటిని వ్యవసాయ శాఖ అధికారులకు అప్పగించారు. For More Latest Political and News Updates :

Show full source text as published

వికారాబాద్‌ జిల్లాలో నకిలీ డీఏపీ కలకలం..| Fake DAP Fertilizer Scam Exposed in Parigi | ABN Telugu వికారాబాద్‌ జిల్లాలో నకిలీ డీఏపీ కలకలం.. ఆందోళనలో రైతులు | Fake DAP Fertilizer Scam Exposed in Parigi | ABN Telugu #vikarabad #parigi #dapfertilizer #telangananews #abntelugu వికారాబాద్ జిల్లా పరిగి నియోజకవర్గంలో నకిలీ డీఏపీ ఎరువును రైతులు పట్టుకున్నారు. వాటిని వ్యవసాయ శాఖ అధికారులకు అప్పగించారు. WATCH ABN LIVE HERE: https://www.youtube.com/watch?v=HoYsWagMFfE For More Latest Political and News Updates : SUBSCRIBE ► ABN NEWS Telugu: https://bit.ly/2XHzSke For all Top and Trending News stories happening all around you #ABNLIVE #ABNNEWS #ABNTeluguLive #ABNTelugu #ABNLIVETELUGU #ABNTeluguLIVE #ABNNEWSLIVE #BreakingNews #FlashNews #SpeedNews --------------------------------------------------------------------------------------------------------------------------------------- ABN LIVE || ABN Telugu Live || Telugu News || 24x7 Live Updates ► Like us on Facebook: https://www.facebook.com/abntelugutv/ ► Circle us on Instagram: https://www.instagram.com/abnajnews/ ► Follow us on X : https://twitter.com/abntelugutv/ ► Follow us on ABN News Portal: https://www.andhrajyothy.com/ ► Follow us on ABN Film News: https://www.chitrajyothy.com/ ABN Mobile App Links: App store: https://apple.co/2GfnKMt Play Store: https://bit.ly/2Lrb09Q SUBSCRIBE ► ABN News Channels for Latest News Updates 24/7 :: ► For ABN Chitrajyothy: https://www.youtube.com/ @ABNChitrajyothy ► For ABN Indian Kitchen:https://www.youtube.com/ @ABNIndianKitchen ► For ABN Digital Exclusives : https://www.youtube.com/ @ABNDigitalExclusives ► For ABN Business&Money : https://www.youtube.com/ @ABNBusiness ► For ABN Sports: https://www.youtube.com/ @ABNSports ► For ABN Tech : www.youtube.com/ @ABNTeluguTech ► For ABN Breaking News : https://www.youtube.com/ @ABNBreakingNews ► For ABN Devotional: https://www.youtube.com/ @ABNDevotional ► For ABN Agri : https://www.youtube.com/ @abnagri ► For ABN Skill School : https://www.youtube.com/ @abnskillschool ► For ABN Health : https://www.youtube.com/ @abn_health ► For ABN Legal : https://www.youtube.com/ @ABNLegal ABN Telugu Live is a 24/7 Telugu news television channel in Andhra Pradesh and Telangana run by Aamoda Broadcasting Network dedicated to the Latest Political News, Live Reports, Exclusive Interviews, Breaking News, Sports News, Weather Updates, Entertainment, Business, and Current Affairs. Watch the latest Telugu News LIVE on the most subscribed news channel on YouTube. Watch all the Current, Latest and Breaking news only on ABN Telugu the one-stop destination for news on Politics, Entertainment, Sports, Crime and business. ABN is one of the leading YouTube News channels which delivers Indian and International news 24x7 in Telugu. ABN Telugu is the most trusted news platform where you can find not only Breaking News and News Headlines but also exclusive interviews and investigative stories. Stay tuned to ABN, the world's most subscribed YouTube news channel for all the latest news and updates from India and across the world. ABN is India's best Telugu News Channel that covers the latest news in Politics, Entertainment, Tollywood, Business and Sports. Enjoy and stay connected with us!! #News #LiveNews #ABN #ABN_Telugu #TelanganaNews #APNews #AndhraPradeshNews #TeluguLiveUpdates #TeluguNewsLive #TeluguLive #LiveTV #TeluguNews #Telugunewslive #TeluguLive #TeluguNews #ABN #latesttelugunews #TeluguNewsChannel #LatestNews #telugu #TeluguBreakingNews #APnews #TelanganaNews #AndhraNews #AndhrapradeshNews #HyderabadNews

English · AI translation

Fake DAP fertilizer chaos in Vikarabad district.. Farmers are worried. In the Parigi constituency of Vikarabad district, farmers caught fake DAP fertilizer and handed it over to agriculture department officials.

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Parigi constituency of Vikarabad district caught fake DAP fertilizer and handed it over to agriculture department officials.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2088ms)

Processing trail
  1. NORMALIZED · 11 Sept, 11:18
  2. RELEVANCE_ACCEPTED · 11 Sept, 11:18
  3. ENRICHED · 11 Sept, 11:19
  4. DEDUPED · 11 Sept, 11:21
  5. NARRATIVE_ASSIGNED · 11 Sept, 11:21
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 9799b843 · raw item a3b673b9 · origin live

YouTubeCVR News TeluguMedia organisation96%11 Aug, 09:57 IST
Bhadradri Kothagudem (91% conf.)Telugustance: critical321 views · 1 likes · 0 comments
Was live

ఆన్లైన్ లో ఎరువులు ఇవ్వడంపై రైతులు ఆగ్రహం | Bhadradri Kothagudem District | CVR News

Original — Telugu

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

ఆన్లైన్ లో ఎరువులు ఇవ్వడంపై రైతులు ఆగ్రహం | Bhadradri Kothagudem District | CVR News #bhadradrikothagudem #telangananews #ureashortage #cvrnews ఆన్లైన్ లో ఎరువులు ఇవ్వడంపై రైతులు ఆగ్రహం | Bhadradri Kothagudem District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Farmers are angry about giving fertilizers online | Bhadradri Kothagudem District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are angry about fertilizers being given online in Bhadradri Kothagudem District.” · confidence 95%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4992ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:35
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:36
  3. ENRICHED · 9 Sept, 22:39
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention d9cf7eef · raw item dcff014b · origin live

YouTubeMedak news channelMedia organisation89%5 Aug, 20:53 IST
Medak (98% conf.)Telugustance: neutral418 views · 0 likes · 0 comments

FFS ద్వారా ఎరువులు విక్రయం కలెక్టర్ ప్రతిమా సింగ్ #subscribe my channel

Original — Telugu

FFS ద్వారా ఎరువులు విక్రయం కలెక్టర్ ప్రతిమా సింగ్ #subscribe my channel

English · AI translation

Fertilizers are being sold through FFS, Collector Pratima Singh #subscribe my channel

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Fertilizers are being sold through FFS, as stated in the text.” · confidence 78%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 84%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2228ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:41
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 45c1dcab · raw item 06e58d68 · origin live

YouTubeBIG TV Telugu LiveMedia organisation94%5 Aug, 11:29 IST
District not evidencedTelugu / Englishstance: neutral53 views · 0 likes · 0 comments

తెలంగాణలో నకిలీ ఎరువులపై విజిలెన్స్ ఫోకస్ | Telangana Vigilance Focus on Fake DAP Fertilizer Scam

Original — Telugu / English

తెలంగాణలో నకిలీ ఎరువులపై విజిలెన్స్ ఫోకస్ | Telangana Vigilance Focus on Fake DAP Fertilizer Scam | BIG TV BIG TV Telugu | Bold New Avatar Voice of the People | Without Fear or Favour Asia's largest immersive news intelligence centre A New Era of News Begins Here.

Show full source text as published

తెలంగాణలో నకిలీ ఎరువులపై విజిలెన్స్ ఫోకస్ | Telangana Vigilance Focus on Fake DAP Fertilizer Scam #FakeDAP #Telangana #vigilance తెలంగాణలో నకిలీ ఎరువులపై విజిలెన్స్ ఫోకస్ | Telangana Vigilance Focus on Fake DAP Fertilizer Scam | BIG TV BIG TV Telugu | Bold New Avatar Voice of the People | Without Fear or Favour Asia's largest immersive news intelligence centre A New Era of News Begins Here. Welcome to Asia's largest immersive news intelligence centre — bringing you breaking news, in-depth reporting, exclusive interviews, and stories that matter, from across Telangana, Andhra Pradesh, and beyond. 👉 Website: https://www.bigtvlive.com/ 👉 Facebook: https://www.facebook.com/BIGTVDigitalNews 👉 Twitter: https://x.com/bigtvtelugu 👉 WhatsApp: https://whatsapp.com/channel/0029VaAe49e72WTw8YM6zr3q 👉 Instagram: https://www.instagram.com/bigtv_telugu Subscribe for authentic Telugu news. Hit the bell icon! 🔔 #bigtvlive #bigtvtelugu #bigtv #bigtvnews #bigtvdigital #bigtvtelugulive

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Vigilance is focusing on fake fertilizer in Telangana.” · confidence 83%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2009ms)

Processing trail
  1. NORMALIZED · 8 Sept, 00:43
  2. RELEVANCE_ACCEPTED · 8 Sept, 00:51
  3. ENRICHMENT_FAILED · 8 Sept, 01:04
  4. ENRICHED · 8 Sept, 01:55
  5. DEDUPED · 8 Sept, 02:09
  6. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  15. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  16. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  17. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  18. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 97947bc4 · raw item f377ea61 · origin live

YouTubePrime9 NewsMedia organisation98%4 Aug, 16:45 IST
Nagarkurnool (99% conf.)Telugu / Englishstance: neutral75 views · 2 likes · 0 comments

Fake Fertilizer Gang Arrested : నాగర్ కర్నూల్ జిల్లాలో నకిలీ ఎరువుల ముఠా గుట్టురట్టు | Prime9 News

Original — Telugu / English

Fake Fertilizer Gang Arrested : నాగర్ కర్నూల్ జిల్లాలో నకిలీ ఎరువుల ముఠా గుట్టురట్టు | Prime9 News

Show full source text as published

Fake Fertilizer Gang Arrested : నాగర్ కర్నూల్ జిల్లాలో నకిలీ ఎరువుల ముఠా గుట్టురట్టు | Prime9 News #fakefertilizer #nagarkarnool #latestnews #trending #breakingnews #viral #prime9news #breakingnews Fake Fertilizer Gang Arrested : నాగర్ కర్నూల్ జిల్లాలో నకిలీ ఎరువుల ముఠా గుట్టురట్టు | Prime9 News Kindly subscribe.. Prime9News - https://www.youtube.com/Prime9News/videos Prime9 Digital - https://www.youtube.com/@Prime9DigitalTelugu WATCH LIVE - https://youtu.be/4PpS_RGUzfQ Follow Prime9 News.. Prime9 Website - https://prime9news.com/ Prime9 Facebook - https://www.facebook.com/prime9news Prime9 Twitter - https://twitter.com/prime9news Prime9 Instagram - https://www.instagram.com/prime9news/

English · AI translation

Fake Fertilizer Gang Arrested: Fake fertilizer gang exposed in Nagarkurnool district | Prime9 News

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A fake fertilizer gang was exposed and arrested in Nagarkurnool district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3909ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:41
  3. ENRICHED · 10 Sept, 19:43
  4. DEDUPED · 10 Sept, 19:44
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 96cd7e1b · raw item a13789ca · origin live

YouTubeBRK News Live HDMedia organisation93%4 Aug, 16:18 IST
Nagarkurnool (99% conf.)Telugu / Englishstance: neutral77 views · 1 likes · 0 comments
Was live

నాగర్‌కర్నూల్ లో బయటపడ్డ నకిలీ ఎరువుల బృందం | Nagarkurnool Fake Fertilizer Case |Telangana |BRKNEWS|

Original — Telugu / English

నాగర్‌కర్నూల్ లో బయటపడ్డ నకిలీ ఎరువుల బృందం | Nagarkurnool Fake Fertilizer Case |Telangana BRK News is a 24x7 satellite telugu news channel and examines news with in-depth analysis. We provide much more than the latest news and breaking news of the day. Brk news takes the lead with its ground-breaking innovation and disruption of a new content category. It is your one-stop destination for all the live news updates from two telugu states and around the india. Brk news makes news accessible for you at your convenience, at all times and across devices. Also Connect us on::

Show full source text as published

నాగర్‌కర్నూల్ లో బయటపడ్డ నకిలీ ఎరువుల బృందం | Nagarkurnool Fake Fertilizer Case |Telangana |BRKNEWS| #nagarkurnool #telangana #fakefertilizer #fakefertilizerscam #farmers #agriculture #brknews నాగర్‌కర్నూల్ లో బయటపడ్డ నకిలీ ఎరువుల బృందం | Nagarkurnool Fake Fertilizer Case |Telangana BRK News is a 24x7 satellite telugu news channel and examines news with in-depth analysis. We provide much more than the latest news and breaking news of the day. Brk news takes the lead with its ground-breaking innovation and disruption of a new content category. It is your one-stop destination for all the live news updates from two telugu states and around the india. Brk news makes news accessible for you at your convenience, at all times and across devices. #BRKNews #brknewstelugu #brknewslatestupdate #brknewsapts Also Connect us on:: ►Subscribe to BRK News🔔: https://shorturl.at/aqx37 ►Join us on Whatsapp : https://shorturl.at/iHJRU ►Follow us on Websitte : http://brknews.in/ ►Follow us on Instagram : https://www.instagram.com/brknews_telugu/ ► Follow us on Twitter : https://x.com/BRKTelugu_1

English · AI translation

A fake fertilizer group exposed in Nagarkurnool | Nagarkurnool Fake Fertilizer Case | Telangana | BRKNEWS | A fake fertilizer group exposed in Nagarkurnool | Nagarkurnool Fake Fertilizer Case | Telangana BRK News is a 24x7 satellite Telugu news channel and examines news with in-depth analysis. We provide much more than the latest news and breaking news of the day. Brk news takes the lead with its ground-breaking innovation and disruption of a new content category. It is your one-stop destination for all the live news updates from two Telugu states and around India. Brk news makes news accessible for you at your convenience, at all times and across devices. Also Connect us on::

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A fake fertilizer group was exposed in Nagarkurnool.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3458ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:41
  3. ENRICHED · 10 Sept, 19:43
  4. DEDUPED · 10 Sept, 19:44
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention d298fd11 · raw item cf19741e · origin live

YouTubeCVR News TeluguMedia organisation96%4 Aug, 10:52 IST
Nagarkurnool (96% conf.)Telugu / Englishstance: neutral406 views · 1 likes · 0 comments
Was live

నకిలీ ఎరువుల కలకలం | Fake Fertilizers In Nagarkurnool District | CVR News

Original — Telugu / English

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

నకిలీ ఎరువుల కలకలం | Fake Fertilizers In Nagarkurnool District | CVR News #fakefertilizer #farmerprotest #nagarkurnooldistrict #breakingnews #cvrnews నకిలీ ఎరువుల కలకలం | Fake Fertilizers In Nagarkurnool District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Fake fertilizer commotion | Fake Fertilizers In Nagarkurnool District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availabilityseedsfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fake fertilizer issue in Nagarkurnool district.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 95%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2626ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:35
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:36
  3. ENRICHED · 9 Sept, 22:39
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 9761fd99 · raw item c22c946c · origin live

YouTubeCVR News TeluguMedia organisation96%1 Aug, 16:28 IST
Vikarabad · Tandur (97% conf.)Telugustance: neutral552 views · 3 likes · 0 comments
Was live

తాండూరులో భారీగా నకిలీ డీఏపీ (DAP) ఎరువులు పట్టివేత! || Fake DAP Seized At Tandur || CVR News

Original — Telugu

తాండూరులో భారీగా నకిలీ డీఏపీ (DAP) ఎరువులు పట్టివేత! || Fake DAP Seized At Tandur || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

తాండూరులో భారీగా నకిలీ డీఏపీ (DAP) ఎరువులు పట్టివేత! || Fake DAP Seized At Tandur || CVR News #tandur #fakedapfertilisers #breakingnews #cvrnews తాండూరులో భారీగా నకిలీ డీఏపీ (DAP) ఎరువులు పట్టివేత! || Fake DAP Seized At Tandur || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Huge seizure of fake DAP (DAP) fertilizers in Tandur! || Fake DAP Seized At Tandur || CVR News Huge seizure of fake DAP (DAP) fertilizers in Tandur! || Fake DAP Seized At Tandur || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availabilityfake-seeds
Open original source ↗
AI interpretation & provenance
Extracted claim

“Fake DAP fertilizers were seized in Tandur.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 98%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 15089ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:53
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 9d1d9dd8 · raw item c7eb84a1 · origin live

YouTubeT News teluguMedia organisation96%1 Aug, 16:03 IST
Vikarabad · Tandur (98% conf.)Englishstance: neutral361 views · 0 likes · 0 comments

Fake DAP Fertilizer Bags Identified in Tandur Mandal | Farmers on Alert | T News

Original — English

Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now!

Show full source text as published

Fake DAP Fertilizer Bags Identified in Tandur Mandal | Farmers on Alert | T News Fake DAP Fertilizer Bags Identified in Tandur Mandal | Farmers on Alert | T News Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now! Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://www.youtube.com/watch?v=ANU5_XHW2wA ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fake DAP fertilizer bags were identified in Tandur Mandal.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 96%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1791ms)

Processing trail
  1. NORMALIZED · 8 Sept, 00:43
  2. RELEVANCE_ACCEPTED · 8 Sept, 00:51
  3. ENRICHMENT_FAILED · 8 Sept, 01:04
  4. ENRICHED · 8 Sept, 01:55
  5. DEDUPED · 8 Sept, 02:09
  6. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  15. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  16. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  17. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  18. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 0bde7cb6 · raw item 5cd05b33 · origin live

XNamasthe Telangana@ntdailyonlineMedia organisation98%1 Aug, 09:40 IST
District not evidencedTelugustance: neutral435 views · 0 likes · 0 reposts · 0 comments
Original — Telugu

ఎరువుల కొరత లేకుండా చర్యలు తీసుకోండి : తుమ్మల

English · AI translation

Take measures to ensure there is no shortage of fertilizers: Thummala

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Thummala asked for measures to ensure there is no fertilizer shortage.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 92%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1963ms)

Processing trail
  1. NORMALIZED · 29 Aug, 14:53
  2. RELEVANCE_ACCEPTED · 29 Aug, 14:54
  3. ENRICHED · 29 Aug, 14:56
  4. DEDUPED · 29 Aug, 15:13
  5. NARRATIVE_ASSIGNED · 29 Aug, 15:13
  6. ENRICHED · 8 Sept, 01:29
  7. DEDUPED · 8 Sept, 02:08
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention f585bcf4 · raw item ba3771c5 · origin live

YouTubeTelanganaInsiderMedia organisation90%31 Jul, 21:31 IST
Suryapet (98% conf.)Telugu / Englishstance: neutral349 views · 1 likes · 0 comments

నకిలీ డీఏపీ తయారీ ముఠా గుట్టురట్టు.. రూ.2 కోట్ల యంత్రాలు స్వాధీనం.#Suryapet #FakeDAP #FertilizerScam

Original — Telugu / English

నకిలీ డీఏపీ తయారీ ముఠా గుట్టురట్టు.. రూ.2 కోట్ల యంత్రాలు స్వాధీనం.#Suryapet సూర్యాపేట జిల్లా హుజూర్‌నగర్ పోలీసులు రైతులను లక్ష్యంగా చేసుకుని నకిలీ డీఏపీ అడుగు మందులు తయారు చేసి విక్రయిస్తున్న ముఠాను బట్టబయలు చేశారు. హైదరాబాద్ కేంద్రంగా తయారీ నిర్వహిస్తూ మఠంపల్లి, మేళ్లచెరువు మండలాలతో పాటు రాష్ట్రంలోని పలు ప్రాంతాలకు ఈ నకిలీ ఉత్పత్తులను సరఫరా చేస్తున్నట్లు దర్యాప్తులో గుర్తించారు. ఈ కేసులో మొత్తం ఎనిమిది మంది నిందితుల్లో ఆరుగురిని పోలీసులు అరెస్టు చేశారు. వారి వద్ద నుంచి ఒక డీసీఎం వాహనం, మారుతి ఎర్టిగా కారు, ఐదు సెల్‌ఫోన్లు, వివిధ కంపెనీలకు చెందిన 4 వేల నుంచి 5 వేల డీఏపీ అడుగు మందు బస్తాలు, సుమారు రూ.2 కోట్ల విలువైన తయారీ యంత్రాలను స్వాధీనం చేసుకున్నారు. రైతులను మోసం చేస్తున్న ఈ నకిలీ నెట్‌వర్క్‌పై మరింత లోతుగా విచారణ కొనసాగుతోందని పోలీసులు తెలిపారు. Huzurnagar Police in Suryapet district have busted an alleged racket involved in manufacturing and selling fake DAP fertilizer products to farmers. The investigation revealed that the operation was being run from Hyderabad and supplied products to several parts of Telangana. Six of the eight accused have been arrested. Police seized a DCM vehicle, a Maruti Ertiga, five mobile phones, around 4,000–5,000 bags of fake DAP products, and manufacturing machinery worth nearly ₹2 crore. The investigation into the wider network is continuing.

Show full source text as published

నకిలీ డీఏపీ తయారీ ముఠా గుట్టురట్టు.. రూ.2 కోట్ల యంత్రాలు స్వాధీనం.#Suryapet #FakeDAP #FertilizerScam 🚨 నకిలీ డీఏపీ అడుగు మందుల ముఠా గుట్టురట్టు.. రూ.2 కోట్ల యంత్రాలు స్వాధీనం సూర్యాపేట జిల్లా హుజూర్‌నగర్ పోలీసులు రైతులను లక్ష్యంగా చేసుకుని నకిలీ డీఏపీ అడుగు మందులు తయారు చేసి విక్రయిస్తున్న ముఠాను బట్టబయలు చేశారు. హైదరాబాద్ కేంద్రంగా తయారీ నిర్వహిస్తూ మఠంపల్లి, మేళ్లచెరువు మండలాలతో పాటు రాష్ట్రంలోని పలు ప్రాంతాలకు ఈ నకిలీ ఉత్పత్తులను సరఫరా చేస్తున్నట్లు దర్యాప్తులో గుర్తించారు. ఈ కేసులో మొత్తం ఎనిమిది మంది నిందితుల్లో ఆరుగురిని పోలీసులు అరెస్టు చేశారు. వారి వద్ద నుంచి ఒక డీసీఎం వాహనం, మారుతి ఎర్టిగా కారు, ఐదు సెల్‌ఫోన్లు, వివిధ కంపెనీలకు చెందిన 4 వేల నుంచి 5 వేల డీఏపీ అడుగు మందు బస్తాలు, సుమారు రూ.2 కోట్ల విలువైన తయారీ యంత్రాలను స్వాధీనం చేసుకున్నారు. రైతులను మోసం చేస్తున్న ఈ నకిలీ నెట్‌వర్క్‌పై మరింత లోతుగా విచారణ కొనసాగుతోందని పోలీసులు తెలిపారు. 🚨 Fake DAP Fertilizer Racket Busted; Machinery Worth ₹2 Crore Seized Huzurnagar Police in Suryapet district have busted an alleged racket involved in manufacturing and selling fake DAP fertilizer products to farmers. The investigation revealed that the operation was being run from Hyderabad and supplied products to several parts of Telangana. Six of the eight accused have been arrested. Police seized a DCM vehicle, a Maruti Ertiga, five mobile phones, around 4,000–5,000 bags of fake DAP products, and manufacturing machinery worth nearly ₹2 crore. The investigation into the wider network is continuing. #Suryapet #FakeDAP #FertilizerScam #Farmers #HuzurnagarPolice #BreakingNews #Telangana #TeluguNews

English · AI translation

The fake DAP manufacturing gang has been exposed.. machinery worth Rs. 2 crore seized. #Suryapet #FakeDAP #FertilizerScam The fake DAP manufacturing gang has been exposed.. machinery worth Rs. 2 crore seized. #Suryapet Police in Huzurnagar, Suryapet district exposed a gang that was manufacturing fake DAP fertilizer and selling it targeting farmers. The investigation found that the production was being carried out from Hyderabad and that the fake products were being supplied to several parts of the state, including Mattampalli and Mellacheruvu mandals. In this case, out of a total of eight accused, six have been arrested by the police. Police seized one DCM vehicle, one Maruti Ertiga car, five cell phones, 4,000 to 5,000 bags of fake DAP fertilizer of various companies, and manufacturing machinery worth about Rs. 2 crore. Police said a deeper investigation into the fake network cheating farmers is continuing. Huzurnagar Police in Suryapet district have busted an alleged racket involved in manufacturing and selling fake DAP fertilizer products to farmers. The investigation revealed that the operation was being run from Hyderabad and supplied products to several parts of Telangana. Six of the eight accused have been arrested. Police seized a DCM vehicle, a Maruti Ertiga, five mobile phones, around 4,000–5,000 bags of fake DAP products, and manufacturing machinery worth nearly ₹2 crore. The investigation into the wider network is continuing.

fertilizer-availabilityseed-outbreakfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Police in Suryapet district busted a racket that was manufacturing and selling fake DAP fertilizer products to farmers.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4626ms)

Processing trail
  1. NORMALIZED · 11 Sept, 06:21
  2. RELEVANCE_ACCEPTED · 11 Sept, 06:21
  3. ENRICHED · 11 Sept, 06:21
  4. DEDUPED · 11 Sept, 06:22
  5. NARRATIVE_ASSIGNED · 11 Sept, 06:22
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention d4d89e93 · raw item 3f03e36c · origin live

YouTubeICKONN TVMedia organisation93%31 Jul, 13:18 IST
Vikarabad · yalala (98% conf.)Telugustance: neutral40 views · 0 likes · 0 comments

వికారాబాద్‌లో నకిలీ DAP ఎరువుల దందా బట్టబయలు..! 43 బస్తాలు స్వాధీనం..! #dap #vikarabad #yt #viral

Original — Telugu

వికారాబాద్‌లో నకిలీ DAP ఎరువుల దందా బట్టబయలు..! 43 బస్తాలు స్వాధీనం..! వికారాబాద్ జిల్లా యాలాల మండలం హాజీపూర్ గ్రామంలో నకిలీ DAP ఎరువులు అక్రమంగా విక్రయిస్తున్నారనే సమాచారంతో వ్యవసాయ శాఖ అధికారులు, పోలీసులు సంయుక్తంగా తనిఖీలు నిర్వహించారు. ఈ దాడుల్లో 43 అనుమానాస్పద DAP ఎరువుల బస్తాలను స్వాధీనం చేసుకున్నట్లు అధికారులు తెలిపారు. ప్రాథమిక విచారణలో ఈ ఎరువుల సరఫరాకు సంబంధించి వివరాలు వెలుగులోకి వచ్చినట్లు పేర్కొన్నారు. కేసు నమోదు చేసి, నకిలీ ఎరువుల సరఫరా గొలుసుపై మరింత దర్యాప్తు కొనసాగుతోంది. వ్యవసాయ శాఖ రైతులకు అధికారిక లైసెన్స్ ఉన్న దుకాణాల నుంచే ఎరువులు కొనుగోలు చేయాలని, తప్పనిసరిగా బిల్లు తీసుకోవాలని సూచించింది. గమనిక: ఈ వీడియోలోని సమాచారం వ్యవసాయ శాఖ, పోలీసుల ప్రాథమిక వివరాల ఆధారంగా రూపొందించబడింది. కేసుకు సంబంధించిన పూర్తి నిజానిజాలు దర్యాప్తు అనంతరం తేలనున్నాయి. ⸻

Show full source text as published

వికారాబాద్‌లో నకిలీ DAP ఎరువుల దందా బట్టబయలు..! 43 బస్తాలు స్వాధీనం..! #dap #vikarabad #yt #viral వికారాబాద్ జిల్లా యాలాల మండలం హాజీపూర్ గ్రామంలో నకిలీ DAP ఎరువులు అక్రమంగా విక్రయిస్తున్నారనే సమాచారంతో వ్యవసాయ శాఖ అధికారులు, పోలీసులు సంయుక్తంగా తనిఖీలు నిర్వహించారు. ఈ దాడుల్లో 43 అనుమానాస్పద DAP ఎరువుల బస్తాలను స్వాధీనం చేసుకున్నట్లు అధికారులు తెలిపారు. ప్రాథమిక విచారణలో ఈ ఎరువుల సరఫరాకు సంబంధించి వివరాలు వెలుగులోకి వచ్చినట్లు పేర్కొన్నారు. కేసు నమోదు చేసి, నకిలీ ఎరువుల సరఫరా గొలుసుపై మరింత దర్యాప్తు కొనసాగుతోంది. వ్యవసాయ శాఖ రైతులకు అధికారిక లైసెన్స్ ఉన్న దుకాణాల నుంచే ఎరువులు కొనుగోలు చేయాలని, తప్పనిసరిగా బిల్లు తీసుకోవాలని సూచించింది. గమనిక: ఈ వీడియోలోని సమాచారం వ్యవసాయ శాఖ, పోలీసుల ప్రాథమిక వివరాల ఆధారంగా రూపొందించబడింది. కేసుకు సంబంధించిన పూర్తి నిజానిజాలు దర్యాప్తు అనంతరం తేలనున్నాయి. 👍 వీడియో నచ్చితే Like చేయండి 💬 మీ అభిప్రాయాన్ని కామెంట్‌లో తెలియజేయండి. 🔔 ఇలాంటి తాజా వ్యవసాయ, తెలంగాణ మరియు బ్రేకింగ్ న్యూస్ కోసం మా ఛానల్‌ను Subscribe చేయండి. ⸻ Fake DAP Fertilizer, Vikarabad News, Yalal News, Hajipur Village, Fake Fertilizer, Agriculture Department, Telangana News, DAP Fertilizer, Farmers Alert, Fake Fertilizer Raid, Breaking News Telugu, Latest Telangana News, Fake DAP Fertilizer, Vikarabad News, Yalal News, Hajipur Village, Fake Fertilizer, Agriculture Department, Telangana News, Farmers News, DAP Fertilizer, Breaking News Telugu, Latest Telangana News, Agriculture News, Fake Fertilizer Raid, Farmer Alert, Today News ⸻ #FakeDAP #DAPFertilizer #Vikarabad #Telangana #Farmers #Agriculture #BreakingNews #TeluguNews #LatestNews #FarmersAlert #FakeFertilizer #NewsUpdate ⸻ Fake DAP Fertilizer, Vikarabad News, Yalal News, Hajipur Village, Fake Fertilizer, Agriculture Department, Telangana News, Farmers News, DAP Fertilizer, Breaking News Telugu, Latest Telangana News, Agriculture News, Fake Fertilizer Raid, Farmer Alert, Today News

English · AI translation

Fake DAP fertilizer racket exposed in Vikarabad..! 43 bags seized..! Fake DAP fertilizer racket exposed in Vikarabad..! 43 bags seized..! In Hajipur village of Yalala mandal, Vikarabad district, based on information that fake DAP fertilizer was being sold illegally, Agriculture Department officials and police jointly conducted inspections. In these raids, officials said 43 suspicious bags of DAP fertilizer were seized. In the preliminary inquiry, they said details related to the supply of this fertilizer came to light. A case has been registered and further investigation into the fake fertilizer supply chain is continuing. The Agriculture Department advised farmers to buy fertilizers only from licensed shops and to обязательно take a bill. Note: The information in this video is based on the preliminary details of the Agriculture Department and police. The full facts of the case will be known after the investigation.

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Agriculture department officials and police jointly inspected a case in Yalala mandal, Vikarabad district, and seized 43 suspicious bags of DAP fertilizer.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3319ms)

Processing trail
  1. NORMALIZED · 8 Sept, 00:43
  2. RELEVANCE_ACCEPTED · 8 Sept, 00:51
  3. ENRICHMENT_FAILED · 8 Sept, 00:59
  4. ENRICHED · 8 Sept, 01:25
  5. DEDUPED · 8 Sept, 02:08
  6. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  15. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  16. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  17. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  18. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 3ac67f8f · raw item 4b55c7a4 · origin live

YouTubeStudio18NewsMedia organisation91%30 Jul, 20:41 IST
Peddapalli (98% conf.)Telugustance: neutral62 views · 2 likes · 0 comments

#Peddapalli : ఎరువుల కర్మాగారం వద్ద వరద నీరు ll ♥studio18news

Original — Telugu

ఆంధ్రప్రదేశ్ & తెలంగాణలో మీ స్వంత ప్రాంతాల నుండి “studio 18 News” రిపోర్టర్లుగా పనిచేయడానికి వెంటనే సంప్రదించండి: 7799975556. “studio 18 News” ఇప్పుడు సోషల్ మీడియాలో సైతం అందుబాటులో ఉంది .. వెంటనే ఫాలో చేయాండి.. THREADS: www.threads.net/@studio18newsofficial JOIN OUR OFFICIAL WHATSAPP GROUP: 0:00 Notification 1:00 Chapter 1 2:00 Chapter 2 3:00 Chapter 3 3:00 Concept 5:00 Main Chapter

Show full source text as published

#Peddapalli : ఎరువుల కర్మాగారం వద్ద వరద నీరు ll ♥studio18news ఆంధ్రప్రదేశ్ & తెలంగాణలో మీ స్వంత ప్రాంతాల నుండి “studio 18 News” రిపోర్టర్లుగా పనిచేయడానికి వెంటనే సంప్రదించండి: 7799975556. “studio 18 News” ప్రసరాలను మీ మోబైల్ పై 24x7 లైవ్ ద్వారా చూడటానికి Google Play Store నుండి “studio18Live” యాప్‌ను డౌన్‌లోడ్ చేయండి. లేదా యాప్‌ను పొందడానికి ఇక్కడ క్లిక్ చేయండి: https://play.google.com/store/apps/details?id=com.swsstudioe&hl=en-IN “studio 18 News” ఇప్పుడు సోషల్ మీడియాలో సైతం అందుబాటులో ఉంది .. వెంటనే ఫాలో చేయాండి.. FACEBOOK: https://www.facebook.com/studio18news TWITTER: https://twitter.com/news_studio18 YOUTUBE: https://www.youtube.com/c/studio18newstelugu INSTAGRAM: https://www.instagram.com/studio18newsofficial/ THREADS: www.threads.net/@studio18newsofficial JOIN OUR OFFICIAL WHATSAPP GROUP: https://chat.whatsapp.com/F4zIisvBK5g0Ru49PXCN20 JOIN OUR OFFICIAL TELEGRAM GROUP: https://t.me/Studio18news #breakingnews #latestnews #indianews #telugunews #newsupdate #telangananews #andhrapradeshnews #liveupdates #politicalnews #viralnews #studio18news #studio18 #studio18telugu #telugunewsupdates #tealngananews #andhranews #studio18newstelugu 0:00 Notification 1:00 Chapter 1 2:00 Chapter 2 3:00 Chapter 3 3:00 Concept 5:00 Main Chapter

English · AI translation

#Peddapalli: Flood water at the fertilizer factory || ♥studio18news Contact immediately to work as studio 18 News reporters from your own areas in Andhra Pradesh and Telangana: 7799975556. "studio 18 News" is now available on social media as well.. follow immediately.. THREADS: www.threads.net/@studio18newsofficial JOIN OUR OFFICIAL WHATSAPP GROUP: 0:00 Notification 1:00 Chapter 1 2:00 Chapter 2 3:00 Chapter 3 3:00 Concept 5:00 Main Chapter

fertilizer-availabilitycrop-damageflooding
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is floodwater at a fertilizer factory in Peddapalli.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 70%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3482ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:45
  7. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  10. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  11. NARRATIVE_ASSIGNED · 17 Sept, 21:03
  12. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  13. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  14. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  15. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  16. NARRATIVE_ASSIGNED · 20 Sept, 19:46
  17. NARRATIVE_ASSIGNED · 20 Sept, 23:14
  18. NARRATIVE_ASSIGNED · 21 Sept, 01:30
  19. NARRATIVE_ASSIGNED · 21 Sept, 11:17
  20. NARRATIVE_ASSIGNED · 21 Sept, 22:43
  21. NARRATIVE_ASSIGNED · 22 Sept, 05:33

mention 0926da31 · raw item 19d81c8c · origin live

YouTubeNTV LiveMedia organisation99%28 Jul, 13:18 IST
Vikarabad (98% conf.)Englishstance: neutral2,715 views · 0 comments

Huge Fake DAP Fertilizer Racket Busted in Vikarabad | NTV Telugu

Original — English

For more latest updates on news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

Show full source text as published

Huge Fake DAP Fertilizer Racket Busted in Vikarabad | NTV Telugu Watch Live Here : https://youtu.be/_kPE2uUR8SI #vikarabad #fakedapfertilizer #ntvtelugu #ntvlive #ntvpolitics For more latest updates on news : ► Visit Our Website : https://ntvtelugu.com/ ► Subscribe to NTV News Channel: http://goo.gl/75PJ6m ► Like us on Facebook: http://www.facebook.com/NtvTelugu ► Follow us on Twitter At : http://www.twitter.com/ntvteluguhd ► Circle us on NTV News Channel G+: http://goo.gl/sJy2d8 Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A fake DAP fertilizer racket was busted in Vikarabad.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2437ms)

Processing trail
  1. NORMALIZED · 11 Sept, 11:18
  2. RELEVANCE_ACCEPTED · 11 Sept, 11:18
  3. ENRICHED · 11 Sept, 11:20
  4. DEDUPED · 11 Sept, 11:21
  5. NARRATIVE_ASSIGNED · 11 Sept, 11:21
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention cf335e7a · raw item a4b507e0 · origin live

YouTubeV6 News TeluguMedia organisation99%27 Jul, 15:00 IST
District not evidencedTelugu / Englishstance: neutral661 views · 5 likes · 0 comments

Farmers Gets Cheated After Buying Fake DAP From Middlemen | V6 News

Original — Telugu / English

Watch Teenmaar Full Episode ఫ్యూచర్ సిటీలో అమెజాన్ డేటా సెంటర్ సర్కార్ బడిల సీఎం స్పీచ్ సూపర్ ఎవుసం మీద ఎల్ నినో దెబ్బ పాటలతో పిల్లల పబ్బతి రేపటి నుంచే బోనాలు ఈ రెండ్రోజులే బతుకొచ్చు.. నీ ఆత్రం అంగట్లవోను.. బీరు తాగుకుంట డ్రైవింగ్ స్విగ్గిలో గ్యాస్ సప్లై భక్తులకు ఫుల్ సెక్యూరిటీ మహా పాల కల్తీ (మహా వేరే కలర్ లో ఉండాలి... 2 కోట్ల 30 లక్షల లీటర్లు దేశమంత గడ్డి మందు బంద్ Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News"

Show full source text as published

Farmers Gets Cheated After Buying Fake DAP From Middlemen | V6 News Farmers Gets Cheated After Buying Fake DAP From Middlemen | V6 News Watch Teenmaar Full Episode https://youtu.be/gNz1uBrh_ec ఫ్యూచర్ సిటీలో అమెజాన్ డేటా సెంటర్ సర్కార్ బడిల సీఎం స్పీచ్ సూపర్ https://youtu.be/jqOlwRV0tDI ఎవుసం మీద ఎల్ నినో దెబ్బ పాటలతో పిల్లల పబ్బతి https://youtu.be/5pTXZMRsxDQ రేపటి నుంచే బోనాలు https://youtu.be/mzW-cGYL6i8 ఈ రెండ్రోజులే బతుకొచ్చు.. https://youtu.be/tGBKTCvFZPU నీ ఆత్రం అంగట్లవోను.. బీరు తాగుకుంట డ్రైవింగ్ https://youtu.be/i8hhRmI_l4A స్విగ్గిలో గ్యాస్ సప్లై https://youtu.be/NvEEbukM_YM భక్తులకు ఫుల్ సెక్యూరిటీ https://youtu.be/-5qvZD6YAp8 మహా పాల కల్తీ (మహా వేరే కలర్ లో ఉండాలి... 2 కోట్ల 30 లక్షల లీటర్లు https://youtu.be/foVkO23TDxs దేశమంత గడ్డి మందు బంద్ https://youtu.be/K1WpJmC1ECs Watch LIVE Stream : https://www.youtube.com/watch?v=nrb8P8shbDk ► Subscribe to V6 News : https://www.youtube.com/c/V6NewsTelugu ► Subscribe to V6 Life : https://www.youtube.com/c/V6Life ► Follow Us On Dailymotion : https://www.dailymotion.com/v6newstelugu ► Like us on Facebook : http://www.facebook.com/V6News.tv ► Follow us on Instagram : https://www.instagram.com/v6newstelugu/ ► Follow us on Twitter : https://twitter.com/V6News ► Visit Website : http://www.v6velugu.com/ ► Join Us On Telegram : https://t.me/V6NewsTelugu Watch V6 Programs Here ►Teenmaar : https://rb.gy/qn91pg ►Trending Videos : https://rb.gy/f6i0x2 ►Top News : https://rb.gy/wqjeun ►HD Playlist : https://rb.gy/veit87 ►Innerview : https://rb.gy/83izwa ►Medaram Jatara : https://rb.gy/mn4tu7 ►Chandravva : https://rb.gy/nja3cl ►Spotlight : https://rb.gy/4lfm9s ►Dhoom Thadaka : https://rb.gy/hvytxl ►V6 Songs : https://rb.gy/68n90s ►Life Mates : https://rb.gy/itvwfa News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News" #FakeDAP #DAPFertilizer #Farmers #FarmerNews #Agriculture #FertilizerScam #CropLoss #V6News #V6 #V6Velugu #TelanganaNews #Telangana

English · AI translation

Farmers Gets Cheated After Buying Fake DAP From Middlemen | V6 News Watch Teenmaar Full Episode Amazon data center in Future City The Chief Minister's speech on the government schools is super El Nino impact on crops Children's upbringing with songs Bonalu starts from tomorrow Only these two days, you can survive.. Don't be greedy.. Drinking and driving Gas supply in Swiggy Full security for devotees Maha milk adulteration (Maha should be in a different color... 230 million liters All-India herbicide ban Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel also airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (celebrity interviews) Cinema Talkies, City Nazaria (program describing the most happening & visiting places in Hyderabad), Mana Palle (describes villages and specialties), Also V6 News Channel is famous for 'Bonalu Songs', 'Bathukamma Songs' and other seasonal and folk related songs. "V6 Teenmaar News", "Teenmaar News"

fertilizer-availabilityinput-costfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers were cheated after buying fake DAP from middlemen.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 74%Agriculture relevance: 92%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3318ms)

Processing trail
  1. NORMALIZED · 8 Sept, 00:43
  2. RELEVANCE_ACCEPTED · 8 Sept, 00:51
  3. ENRICHMENT_FAILED · 8 Sept, 01:04
  4. ENRICHED · 8 Sept, 01:55
  5. DEDUPED · 8 Sept, 02:08
  6. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  7. NARRATIVE_ASSIGNED · 8 Sept, 02:20
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention b3dd4759 · raw item 25316632 · origin live

YouTubeV6 News TeluguMedia organisation99%26 Jul, 20:05 IST
Mahabubnagar (56% conf.)Telugustance: neutral2,018 views · 6 likes · 1 comments

Palamuru Farmers Concerned Over Fake DAP Fertilizer Sales | V6 News

Original — Telugu

Watch Teenmaar Full Episode ఫ్యూచర్ సిటీలో అమెజాన్ డేటా సెంటర్ సర్కార్ బడిల సీఎం స్పీచ్ సూపర్ ఎవుసం మీద ఎల్ నినో దెబ్బ పాటలతో పిల్లల పబ్బతి రేపటి నుంచే బోనాలు ఈ రెండ్రోజులే బతుకొచ్చు.. నీ ఆత్రం అంగట్లవోను.. బీరు తాగుకుంట డ్రైవింగ్ స్విగ్గిలో గ్యాస్ సప్లై భక్తులకు ఫుల్ సెక్యూరిటీ మహా పాల కల్తీ (మహా వేరే కలర్ లో ఉండాలి... 2 కోట్ల 30 లక్షల లీటర్లు దేశమంత గడ్డి మందు బంద్ Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News"

Show full source text as published

Palamuru Farmers Concerned Over Fake DAP Fertilizer Sales | V6 News Palamuru Farmers Concerned Over Fake DAP Fertilizer Sales | V6 News Watch Teenmaar Full Episode https://youtu.be/gNz1uBrh_ec ఫ్యూచర్ సిటీలో అమెజాన్ డేటా సెంటర్ సర్కార్ బడిల సీఎం స్పీచ్ సూపర్ https://youtu.be/jqOlwRV0tDI ఎవుసం మీద ఎల్ నినో దెబ్బ పాటలతో పిల్లల పబ్బతి https://youtu.be/5pTXZMRsxDQ రేపటి నుంచే బోనాలు https://youtu.be/mzW-cGYL6i8 ఈ రెండ్రోజులే బతుకొచ్చు.. https://youtu.be/tGBKTCvFZPU నీ ఆత్రం అంగట్లవోను.. బీరు తాగుకుంట డ్రైవింగ్ https://youtu.be/i8hhRmI_l4A స్విగ్గిలో గ్యాస్ సప్లై https://youtu.be/NvEEbukM_YM భక్తులకు ఫుల్ సెక్యూరిటీ https://youtu.be/-5qvZD6YAp8 మహా పాల కల్తీ (మహా వేరే కలర్ లో ఉండాలి... 2 కోట్ల 30 లక్షల లీటర్లు https://youtu.be/foVkO23TDxs దేశమంత గడ్డి మందు బంద్ https://youtu.be/K1WpJmC1ECs Watch LIVE Stream : https://www.youtube.com/watch?v=nrb8P8shbDk ► Subscribe to V6 News : https://www.youtube.com/c/V6NewsTelugu ► Subscribe to V6 Life : https://www.youtube.com/c/V6Life ► Follow Us On Dailymotion : https://www.dailymotion.com/v6newstelugu ► Like us on Facebook : http://www.facebook.com/V6News.tv ► Follow us on Instagram : https://www.instagram.com/v6newstelugu/ ► Follow us on Twitter : https://twitter.com/V6News ► Visit Website : http://www.v6velugu.com/ ► Join Us On Telegram : https://t.me/V6NewsTelugu Watch V6 Programs Here ►Teenmaar : https://rb.gy/qn91pg ►Trending Videos : https://rb.gy/f6i0x2 ►Top News : https://rb.gy/wqjeun ►HD Playlist : https://rb.gy/veit87 ►Innerview : https://rb.gy/83izwa ►Medaram Jatara : https://rb.gy/mn4tu7 ►Chandravva : https://rb.gy/nja3cl ►Spotlight : https://rb.gy/4lfm9s ►Dhoom Thadaka : https://rb.gy/hvytxl ►V6 Songs : https://rb.gy/68n90s ►Life Mates : https://rb.gy/itvwfa News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News" #palamurufarmers #fakedapfertilizer #fertilizersales #V6News #V6 #V6Velugu #TelanganaNews #Telangana

English · AI translation

Palamuru Farmers Concerned Over Fake DAP Fertilizer Sales | V6 News Watch Teenmaar Full Episode Amazon data center in Future City The CM speech on government schools is super El Nino hit on crops Children's upbringing with songs Bonalu from tomorrow Only these two days to live.. Don't be greedy.. Driving after drinking beer Gas supply on Swiggy Full security for devotees Major adulteration (it should be in a different color... 230 million liters Pesticides banned across the country Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel also airs programs like Teenmaar News, Chandravva & Padma satires etc, Theertham, Muchata (celeb interviews), Cinema Talkies, City Nazaria (program describes the most happening & visiting places in Hyderabad), Mana Palle (describes villages and specialties), Also V6 News Channel is famous for 'Bonalu Songs', 'Bathukamma Songs' and other seasonal and folk related songs. "V6 Teenmaar News", "Teenmaar News"

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Palamuru are concerned about fake DAP fertilizer sales.” · confidence 95%

Sentiment: negativeStance toward government: neutralTelangana relevance: 91%Agriculture relevance: 95%Classification confidence: 79%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3313ms)

Processing trail
  1. NORMALIZED · 11 Sept, 16:04
  2. RELEVANCE_ACCEPTED · 11 Sept, 16:04
  3. ENRICHED · 11 Sept, 16:05
  4. DEDUPED · 11 Sept, 16:06
  5. NARRATIVE_ASSIGNED · 11 Sept, 16:06
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention e131df25 · raw item 83bee62f · origin live

YouTubeSR6NEWSMedia organisation91%23 Jul, 20:29 IST
Nagarkurnool (99% conf.)Telugustance: neutral18 views · 0 likes · 0 comments

SR6NEWS || నాగర్‌కర్నూల్ జిల్లాలో నకిలీ డీఏపీ ఎరువుల ముఠా గుట్టురట్టు

Original — Telugu

Join this channel to get access to perks: Install the app to follow my photos and videos. #SR6 #CBN Chandrababu Naidu #BREAKINGNEWS #TGNEWS #APNEWS #Deputy CM Pawan Kalyan #CM Revanth Reddy #Deputy CM Bhatti Vikramarka

Show full source text as published

SR6NEWS || నాగర్‌కర్నూల్ జిల్లాలో నకిలీ డీఏపీ ఎరువుల ముఠా గుట్టురట్టు Join this channel to get access to perks: https://www.youtube.com/channel/UC9Fyv1SkWeQeZTeIXaURihw/join Welcome To SR6NEWS Official News Channel. This is The Place Where You Will Get Inspiring Video's in Telugu.Latest News, Tollywood Updates And News,Latest Updates, Celebraty News,And Updates, Health Tips,Gossips,Latest Films, Movie's Reviews, Interesting Video's, Viral Video's,Fun, Education, Entertainment, Tradation And Political News,Hope You Will Enjoy Our Video's. 👉 For More Updates like us on Facebook: 👇https://m.facebook.com/SR6News-102755175265873/?ref=bookmarks. 👉 What's up contact :Let's chat on WhatsApp! It's a fast simple, and secure app we can use to message and call each other for free. Get it at 👉 https://whatsapp.com/dl/. 👉 Telegram Number :9951326465. 👉 SR6NEWS Twitter Link: https://twitter.com/news_sr6?t=QozXTPRpJcL9G9WoQpbBBw&s=09. 👉 SR6NEWS Instagram link : I'm on Instagram as @sr6news. Install the app to follow my photos and videos. 👇 https://www.instagram.com/invites/contact/?i=1omm55aygwujq&utm_content=k99mirw #SR6 #CBN Chandrababu Naidu #BREAKINGNEWS #TGNEWS #APNEWS #Deputy CM Pawan Kalyan #CM Revanth Reddy #Deputy CM Bhatti Vikramarka #KCR #KTR #NEWSUPDATE #BREAKINGNEWS #TELANGANANEWS #NEWSUPDATE #NEWS

English · AI translation

SR6NEWS || Fake DAP fertilizer gang exposed in Nagarkurnool district

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A fake DAP fertilizer gang was exposed in Nagarkurnool district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1934ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:40
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 11d5d174 · raw item efa0eeb8 · origin live

YouTubeSrininvasa Fertilizers Dealer94%19 Jul, 18:03 IST
Warangal (72% conf.)Telugu / Englishstance: neutral936 views · 6 likes · 0 comments

Srininvasa Fertilizers Pesticides and Seeds, Shambunipet Warangal #farming #fertilizer #pesticides

Original — Telugu / English

Srininvasa Fertilizers Pesticides and Seeds, Shambunipet Warangal మా దుకాణం శ్రీనివాస ఎరువులు, పురుగుమందులు మరియు విత్తనాలు.( Wholesale మరియు Retail ). మేము ఈ క్రింది వాటి పంపిణీదారులం: 1. క్రిస్టల్ క్రాప్ సైన్స్ 2. ఇన్సెక్టిసైడ్స్ ఇండియా లిమిటెడ్ 3. సేఫెక్స్ కెమికల్స్ లిమిటెడ్ 4. ప్రివి లైఫ్ సైన్స్ 5. బెస్ట్ ఆగ్రో లైఫ్ లిమిటెడ్ 6. క్రిభ్‌కో 7. కోరమండల్ 8. ఐఎఫ్‌ఎఫ్‌సిఓ 9. అనఘ అగ్రి క్రాప్ సైన్స్ 10. హెరాన్బా ఇండస్ట్రీస్ 11. శ్రీకర్ సీడ్స్ 12. అమర్ బయో టెక్ 13. పెన్నా సీడ్స్ మా మొబైల్ నంబర్ 9010606457

English · AI translation

Srininvasa Fertilizers Pesticides and Seeds, Shambunipet Warangal #farming #fertilizer #pesticides Srininvasa Fertilizers Pesticides and Seeds, Shambunipet Warangal Our shop, Srininivasa Fertilizers, Pesticides and Seeds, does wholesale and retail. We are distributors for the following: 1. Crystal Crop Science 2. Insecticides India Limited 3. Safex Chemicals Limited 4. Privi Life Sciences 5. Best Agro Life Limited 6. Kribhco 7. Coromandel 8. IFFCO 9. Anagha Agri Crop Science 10. Heranba Industries 11. Srikar Seeds 12. Amar Bio Tech 13. Penna Seeds Our mobile number 9010606457

fertilizer-availabilityseedsinput-cost
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The shop in Shambunipet, Warangal sells fertilizers, pesticides, and seeds wholesale and retail.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 98%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2781ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:29
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  7. NARRATIVE_ASSIGNED · 11 Sept, 20:32
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  19. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  20. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention eb7b1ffb · raw item 7cac86e4 · origin live

YouTubehmtv Telugu NewsMedia organisation99%18 Jul, 21:00 IST
District not evidencedTelugu / Englishstance: neutral2,175 views · 15 likes · 0 comments

Jordar Varthalu : నకిలీ ఎరువులు ఎలా తయారు చేస్తున్నారో చూడండి | Fake Fertilizers | hmtv

Original — Telugu / English

Stay Connected with hmtv – The Heartbeat of Telugu News! HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

Show full source text as published

Jordar Varthalu : నకిలీ ఎరువులు ఎలా తయారు చేస్తున్నారో చూడండి | Fake Fertilizers | hmtv Jordar Varthalu : నకిలీ ఎరువులు ఎలా తయారు చేస్తున్నారో చూడండి | Fake Fertilizers | hmtv #jordarnews #jordarramulu #jordarvarthalu #hmtvjordarnews #hmtv Stay Connected with hmtv – The Heartbeat of Telugu News! 🔔 Subscribe Now: http://goo.gl/f9lm5E HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: ► FB: https://www.facebook.com/hmtvnewslive ► Twitter: https://twitter.com/hmtvnewslive ► Instagram: https://www.instagram.com/hmtvnewsofficial/?hl=en ►Telegram: https://t.me/hmtvnewslive ► Watch hmtv Live: https://youtube.com/live/3JodH4xoqJs ► Subscribe to hmdgtl: https://www.youtube.com/@hmdgtl?sub_confirmation=1 ► For News in Telugu: http://www.hmtvlive.com/ ► For News in English: http://www.thehansindia.com ► Follow us on our Whatsapp Channel: https://whatsapp.com/channel/0029Va9MPsgCMY0AFP9BeE3n Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. 🔹 24/7 News 🔹 Politics & Current Affairs 🔹 Entertainment & Cinema 🔹 Sports Highlights 🔹 Cultural Stories & Folk Music 🔹 Documentaries & Features 🔹 Interviews & Insights 🔹 Thought-Provoking Debates & Conclaves hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content is about fake fertilizers.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 60%Agriculture relevance: 80%Classification confidence: 78%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1327ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention acab3ee0 · raw item 4327dbf7 · origin live

YouTubeagriculture kurraduCreator85%18 Jul, 19:00 IST
Khammam (84% conf.)Telugustance: neutral53 views · 3 likes · 0 comments

#డ్రిప్ ఎరువులు VS పైన చల్లే ఎరువులు -అసలు తేడా ఇదే! # #agriculture #khammam #farming

Original — Telugu

#డ్రిప్ ఎరువులు VS పైన చల్లే ఎరువులు -అసలు తేడా ఇదే! #

English · AI translation

What is the difference between fertilizers used in drip irrigation and fertilizers broadcast on the surface? Many people have this doubt. The urea and DAP complex fertilizers used for surface application are all in granule form. They do not dissolve completely in water; some remain in the soil. That is why they are called broadcast fertilizers. But the ones used in drip irrigation are completely different. They are called water-soluble fertilizers. They dissolve 100% in water, leaving no residue at all. This is because drip pipes have tiny holes. If undissolved particles are used, the pipes will get blocked. Another important difference is the speed at which nutrients reach the plant. For surface-applied fertilizer to reach the plant root, rain or water is needed. It also takes time. But fertilizer given through drip goes directly near the roots, so the plant absorbs it immediately and wastage is very low. That is why in drip irrigation, better results can be achieved with 20 to 30% less fertilizer. You saw it, right? Comment what you think about this. Also share this valuable information with fellow farmers.

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Water-soluble fertilizers used in drip irrigation dissolve completely in water, unlike broadcast fertilizers such as urea and DAP, and drip application can use 20–30% less fertilizer for better results.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 70%Agriculture relevance: 100%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3641ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 3739cb96 · raw item 50df41e4 · origin live

YouTubehmr TELUGU AGRICULTUREFarmer90%18 Jul, 17:13 IST
District not evidencedTelugustance: neutral3,523 views · 43 likes

పత్తిలో 20-20-0-13 ఎరువులు వేస్తున్నాం? బలమైన వేరు వ్యవస్థ గ్రోత్ కోసం

Original — Telugu

పత్తిలో 20-20-0-13 ఎరువులు వేస్తున్నాం? బలమైన వేరు వ్యవస్థ గ్రోత్ కోసం

English · AI translation

Are we applying 20-20-0-13 fertilizer in cotton? For strong root system growth

fertilizer-availabilitycotton
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“20-20-0-13 fertilizer is being applied in cotton for strong root system growth.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 70%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1935ms)

Processing trail
  1. NORMALIZED · 25 Aug, 09:24
  2. RELEVANCE_ACCEPTED · 25 Aug, 09:24
  3. ENRICHED · 25 Aug, 09:30
  4. DEDUPED · 25 Aug, 09:35
  5. NARRATIVE_ASSIGNED · 25 Aug, 09:35
  6. ENRICHED · 8 Sept, 01:26
  7. DEDUPED · 8 Sept, 02:08
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f31bf56f · raw item 77798471 · origin live

YouTubeTV5 News Media organisation98%16 Jul, 17:58 IST
Nalgonda (99% conf.)Telugu / Englishstance: neutral3,859 views · 30 likes · 1 comments

గిరాకీ లేక వెలవెలబోతున్న దుకాణాలు..El Nino Impact On Fertilizer Shops In Nalgonda District |TV5 News

Original — Telugu / English

గిరాకీ లేక వెలవెలబోతున్న దుకాణాలు..El Nino Impact On Fertilizer Shops In Nalgonda District |TV5 Newsf

Show full source text as published

గిరాకీ లేక వెలవెలబోతున్న దుకాణాలు..El Nino Impact On Fertilizer Shops In Nalgonda District |TV5 News గిరాకీ లేక వెలవెలబోతున్న దుకాణాలు..El Nino Impact On Fertilizer Shops In Nalgonda District |TV5 Newsf Watch TV5 News LIVE : https://www.youtube.com/live/ho9JlBnrGWg The channel telecasts hourly Telugu news bulletins and 30 special news bulletins, with the support of 294 special reporters in every constituency of the Telugu states of Andhra Pradesh and Telangana, in addition to bureaus in Hyderabad, Vishakapatnam, and Vijayawada. Its news bulletins last round 20–25 minutes (without including commercials). One of the channel's notable features is its business content. Market analysts provide financial analysis to the audience on a day-to-day basis. The channel has won the best business show award from a national television awards committee Subscribe to TV5 News for Latest Happenings and Breaking news from Andhra and Telangana. For More Updates ► TV5 News Live : https://youtu.be/ox2rT1KRkFI ► Subscribe to TV5 News Channel: http://goo.gl/NHJD9 ►Our Website : http://www.tv5news.in ► Like us on Facebook: http://www.facebook.com/tv5newschannel ► Follow us on Twitter: https://twitter.com/tv5newsnow ► Follow us on Pinterest: https://www.pinterest.com/tv5newschannel

English · AI translation

Shops are empty due to lack of demand.. El Nino Impact On Fertilizer Shops In Nalgonda District | TV5 News Shops are empty due to lack of demand.. El Nino Impact On Fertilizer Shops In Nalgonda District | TV5 News

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“El Nino has affected fertilizer shops in Nalgonda district, leaving them without customer traffic.” · confidence 78%

Sentiment: neutralStance toward government: neutralTelangana relevance: 94%Agriculture relevance: 88%Classification confidence: 87%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2965ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:00
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 1f24f7af · raw item 3a84eab9 · origin live

XNamasthe Telangana@ntdailyonlineMedia organisation98%14 Jul, 10:00 IST
District not evidencedTelugustance: critical197 views · 0 likes · 0 reposts · 0 comments
Original — Telugu

ఎరువుల ఉచిత రవాణా రద్దు.. రైతుల నెత్తిన సర్కార్‌ మరో పిడుగు రాష్ట్రంలో పీఏసీఎస్‌లకు ఉచిత రవాణా బంద్‌ చేసిన మార్క్‌ఫెడ్‌ గతంలోనే డీసీఎంఎస్‌లు, ఏఆర్‌ఎస్‌కేలకూ నిలిపివేత

English · AI translation

Free transport for fertilizers cancelled.. another blow from the government on farmers' heads Markfed has stopped free transportation for PACS in the state Previously, it had also been stopped for DCMs and ARSes

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Markfed has stopped free transportation for PACS in Telangana, and it had already been stopped for DCMS and ARS in the past.” · confidence 95%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1966ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:32
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:44
  3. ENRICHED · 30 Aug, 01:52
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:26
  6. NARRATIVE_ASSIGNED · 30 Aug, 02:28
  7. ENRICHED · 8 Sept, 01:31
  8. DEDUPED · 8 Sept, 02:08
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  10. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  11. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  12. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  14. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  15. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  16. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  17. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  18. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  19. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  20. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  21. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 7742f523 · raw item 6c713810 · origin live

YouTubePrime9 NewsMedia organisation98%12 Jul, 23:31 IST
Mahabubabad (98% conf.)Telugu / Englishstance: neutral320 views · 1 likes · 0 comments

Tension in Mahabubabad : మహబూబాబాద్ లో ఉద్రిక్తత .. ఎరువుల షాపు దగ్ధం | Prime9 News

Original — Telugu / English

Tension in Mahabubabad : మహబూబాబాద్ లో ఉద్రిక్తత .. ఎరువుల షాపు దగ్ధం | Prime9 News

Show full source text as published

Tension in Mahabubabad : మహబూబాబాద్ లో ఉద్రిక్తత .. ఎరువుల షాపు దగ్ధం | Prime9 News #mahabubabadnews #fertilizer #latestnews #telangananews #prime9news Tension in Mahabubabad : మహబూబాబాద్ లో ఉద్రిక్తత .. ఎరువుల షాపు దగ్ధం | Prime9 News Kindly subscribe.. Prime9News - https://www.youtube.com/Prime9News/videos Prime9 Digital - https://www.youtube.com/@Prime9DigitalTelugu WATCH LIVE - https://youtu.be/4PpS_RGUzfQ Follow Prime9 News.. Prime9 Website - https://prime9news.com/ Prime9 Facebook - https://www.facebook.com/prime9news Prime9 Twitter - https://twitter.com/prime9news Prime9 Instagram - https://www.instagram.com/prime9news/

English · AI translation

Tension in Mahabubabad: Tension in Mahabubabad.. fertilizer shop burned | Prime9 News

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“An fertilizer shop was burned in Mahabubabad.” · confidence 90%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 70%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1897ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention b3ba02e6 · raw item 49631e18 · origin live

YouTubeNTV TeluguMedia organisation99%12 Jul, 13:57 IST
Sangareddy · doulthabad (95% conf.)Telugu / Englishstance: neutral257 views · 1 likes · 0 comments

సంగారెడ్డి జిల్లా దౌల్తాబాద్ లో ఎరువుల కష్టాలు | Sangareddy Dist | Farmers | NTV Telugu

Original — Telugu / English

For more latest updates on the news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

Show full source text as published

సంగారెడ్డి జిల్లా దౌల్తాబాద్ లో ఎరువుల కష్టాలు | Sangareddy Dist | Farmers | NTV Telugu సంగారెడ్డి జిల్లా దౌల్తాబాద్ లో ఎరువుల కష్టాలు | Sangareddy Dist | Farmers | NTV Telugu For more latest updates on the news : ► Visit Our Website : https://ntvtelugu.com/ ► Subscribe to NTV News Channel: http://goo.gl/75PJ6m ► Like us on Facebook: https://www.facebook.com/NtvTeluguLive/ ► Follow us on Twitter At https://twitter.com/ntvtelugulive Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV. #ntvtelugu #ntv #ntvlive #ntvnews #BreakingNews #Headlines #TodayHeadlines #TopNews #PrimeNews #SpeedNews

English · AI translation

Fertilizer difficulties in Doulthabad, Sangareddy district | Sangareddy Dist | Farmers | NTV Telugu For more latest updates on the news: Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There are fertilizer difficulties in Doulthabad, Sangareddy district.” · confidence 90%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 96%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1510ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention aaf6facd · raw item 78b38254 · origin live

YouTubeNTV LiveMedia organisation99%12 Jul, 13:54 IST
Sangareddy (98% conf.)Telugu / Englishstance: neutral240 views · 0 comments

fertilizers shortage in Sanga Reddy district: సంగారెడ్డి జిల్లాలో రైతులకు ఎరువుల కష్టాలు | NTV

Original — Telugu / English

For more latest updates on news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

Show full source text as published

fertilizers shortage in Sanga Reddy district: సంగారెడ్డి జిల్లాలో రైతులకు ఎరువుల కష్టాలు | NTV Watch Live Here : https://youtu.be/_kPE2uUR8SI #ntvtelugu #ntvlive #ntvpolitics For more latest updates on news : ► Visit Our Website : https://ntvtelugu.com/ ► Subscribe to NTV News Channel: http://goo.gl/75PJ6m ► Like us on Facebook: http://www.facebook.com/NtvTelugu ► Follow us on Twitter At : http://www.twitter.com/ntvteluguhd ► Circle us on NTV News Channel G+: http://goo.gl/sJy2d8 Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizers shortage in Sangareddy district.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1482ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention bdc052ff · raw item 01cbd651 · origin live

YouTubeiNews TelanganaMedia organisation98%10 Jul, 13:21 IST
Medak (96% conf.)Telugu / Englishstance: neutral3 views · 0 likes · 0 comments

ఎరువుల కొరతతో మెదక్‌ లో రైతుల ఆగ్రహం! | Fertilizer Shortage Sparks Farmers' Protest in Medak | iNews

Original — Telugu / English

ఎరువుల కొరతతో మెదక్‌ లో రైతుల ఆగ్రహం! | Fertilizer Shortage Sparks Farmers' Protest in Medak | iNews

Show full source text as published

ఎరువుల కొరతతో మెదక్‌ లో రైతుల ఆగ్రహం! | Fertilizer Shortage Sparks Farmers' Protest in Medak | iNews ఎరువుల కొరతతో మెదక్‌ లో రైతుల ఆగ్రహం! | Fertilizer Shortage Sparks Farmers' Protest in Medak | iNews #medaknews #farmersprotest #fertilizershortage #fertilizersupply #agriculture #inews #tsnews ► Like us on Facebook :https://www.facebook.com/INews ► Follow us on Instagram : https://www.instagram.com/inewsofficial/ ► Follow us on Twitter : https://twitter.com/inewstelugu ► Follow us on Official Site : https://inewstelugu.com

English · AI translation

Farmers in Medak are angry due to a fertilizer shortage! | Fertilizer Shortage Sparks Farmers' Protest in Medak | iNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Medak are angry due to a fertilizer shortage.” · confidence 95%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1857ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:30
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:34
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 02b68c37 · raw item d433c2d5 · origin live

YouTubeNTV LiveMedia organisation99%10 Jul, 10:56 IST
Medak (99% conf.)Telugu / Englishstance: neutral308 views · 0 comments

మెదక్ జిల్లాలో రైతులకు ఎరువుల కష్టాలు | Fertilizers Crisis in Medak District | NTV Telugu

Original — Telugu / English

For more latest updates on news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

Show full source text as published

మెదక్ జిల్లాలో రైతులకు ఎరువుల కష్టాలు | Fertilizers Crisis in Medak District | NTV Telugu Watch Live Here : https://youtu.be/_kPE2uUR8SI #medakdistrict #fertilizershortage #ntvtelugu #ntvlive #ntvpolitics For more latest updates on news : ► Visit Our Website : https://ntvtelugu.com/ ► Subscribe to NTV News Channel: http://goo.gl/75PJ6m ► Like us on Facebook: http://www.facebook.com/NtvTelugu ► Follow us on Twitter At : http://www.twitter.com/ntvteluguhd ► Circle us on NTV News Channel G+: http://goo.gl/sJy2d8 Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

English · AI translation

Farmers in Medak district are facing fertilizer difficulties | Fertilizers Crisis in Medak District | NTV Telugu For more latest updates on news: Watch NTV Telugu News Channel, a popular Telugu news channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Medak district are facing fertilizer difficulties.” · confidence 93%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1714ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:30
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:36
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 03b075d4 · raw item 18f0fd1c · origin live

YouTubeNTV TeluguMedia organisation99%10 Jul, 10:38 IST
Medak (98% conf.)Telugustance: neutral172 views · 1 likes · 0 comments

Medak: మెదక్ జిల్లాలో రైతులకు ఎరువుల కష్టాలు | NTV Telugu

Original — Telugu

For more latest updates on the news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

Show full source text as published

Medak: మెదక్ జిల్లాలో రైతులకు ఎరువుల కష్టాలు | NTV Telugu Medak: మెదక్ జిల్లాలో రైతులకు ఎరువుల కష్టాలు | NTV Telugu For more latest updates on the news : ► Visit Our Website : https://ntvtelugu.com/ ► Subscribe to NTV News Channel: http://goo.gl/75PJ6m ► Like us on Facebook: https://www.facebook.com/NtvTeluguLive/ ► Follow us on Twitter At https://twitter.com/ntvtelugulive Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV. #ntvtelugu #ntv #ntvlive #ntvnews #BreakingNews #Headlines #TodayHeadlines #TopNews #PrimeNews #SpeedNews

English · AI translation

Medak: Farmers in Medak district are facing fertilizer difficulties | NTV Telugu For more latest updates on the news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Medak district are facing fertilizer difficulties.” · confidence 88%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2023ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 983a8d4b · raw item a941c102 · origin live

YouTubehari agritechCreator82%10 Jul, 09:12 IST
Khammam (98% conf.)Telugustance: neutral563 views · 2 likes · 0 comments

ఖమ్మం జిల్లాలో రైతు సదస్సులో స్టాల్ no 19 లో ధాత్రి ఎరువులు #trending #viral #agriculture #farming

Original — Telugu

ఖమ్మం జిల్లాలో రైతు సదస్సులో స్టాల్ no 19 లో ధాత్రి ఎరువులు

English · AI translation

At the farmers' conference in Khammam district, Dhatri fertilizers were at stall number 19, #trending #viral #agriculture #farming At the farmers' conference in Khammam district, Dhatri fertilizers were at stall number 19. Hello, today if we look, we are at a farmers' conference in Khammam. Here, our farmer laboratory stall has been set up at stall number 19. Here, our Dhatri fertilizer has been displayed. I request every rice farmer who comes to this stall to learn full details about our fertilizers along with your valuable suggestions, and to use our fertilizers extensively and get higher income. Thank you.

fertilizer-availabilitypaddy
Open original source ↗
AI interpretation & provenance
Extracted claim

“A farmers' conference in Khammam district had stall number 19 displaying Dhatri fertilizers.” · confidence 93%

Sentiment: positiveStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 92%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2867ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 9d10e996 · raw item f73a4c95 · origin live

YouTubeSMK NEWS TELANGANAMedia organisation95%7 Jul, 20:47 IST
Rajanna Sircilla · sircilla (98% conf.)Telugu / Englishstance: neutral41 views · 3 likes · 0 comments

Surprise Inspections of Seed And Fertilizer Shops in Sircilla Strict ActionAgainst Spurious Products

Original — Telugu / English

BHEEJ AUR KHAD KE DUKANO ME ACHANAK MAYENE, NAAQS MASNUAT KE KHILAF SAQT KARWAYEE. సిరిసిల్లలో విత్తన, ఎరువుల దుకాణాల్లో ఆకస్మిక తనిఖీలు; నకిలీ ఉత్పత్తులపై కఠిన చర్యలు. Surprise Inspections of Seed And Fertilizer Shops in Sircilla; Strict Action Against Spurious Products* Rajanna Sircilla District // *Surprise inspections of seed and fertilizer shops in Sircilla; strict action against spurious products* The Agriculture and Police departments jointly conducted surprise inspections in Sircilla district to protect farmers from fraud involving spurious seeds and fertilizers. Officials thoroughly examined records and stock levels at various seed and fertilizer shops across Sircilla Mandal Sircilla Mandal Agriculture Officer Sandeep and Sircilla Town CI Srinivas participated in these inspections, checking stock registers, bill books, and sales records. They instructed traders to mandatorily issue bills to farmers for every sale. Officials warned that licenses would be cancelled and criminal cases registered against anyone selling spurious or expired seeds and fertilizers in violation of government regulations Officials advised farmers to insist on obtaining bills when purchasing seeds and fertilizers and to immediately inform the Agriculture Department or the police if they come across any suspicious products. The local Sub-Inspector (SI), police personnel, and Agriculture Department officials participated in these inspections.

English · AI translation

Surprise inspections of seed and fertilizer shops in Sircilla; strict action against spurious products. Surprise inspections were conducted in the seed and fertilizer shops in Sircilla, and strict action was taken against spurious products. In Rajanna Sircilla district, the Agriculture and Police departments jointly conducted surprise inspections in Sircilla district to protect farmers from fraud involving spurious seeds and fertilizers. Officials thoroughly examined records and stock levels at various seed and fertilizer shops across Sircilla Mandal. Sircilla Mandal Agriculture Officer Sandeep and Sircilla Town CI Srinivas participated in these inspections, checking stock registers, bill books, and sales records. They instructed traders to mandatorily issue bills to farmers for every sale. Officials warned that licenses would be cancelled and criminal cases registered against anyone selling spurious or expired seeds and fertilizers in violation of government regulations. Officials advised farmers to insist on obtaining bills when purchasing seeds and fertilizers and to immediately inform the Agriculture Department or the police if they come across any suspicious products. The local Sub-Inspector, police personnel, and Agriculture Department officials participated in these inspections.

seedsfertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The Agriculture and Police departments jointly conducted surprise inspections of seed and fertilizer shops in Sircilla Mandal, Rajanna Sircilla district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4649ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:00
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention d6306d32 · raw item 24029468 · origin live

YouTubeAIR News HyderabadMedia organisation98%2 Jul, 18:18 IST
Rajanna Sircilla (99% conf.)Telugustance: neutral7 views · 0 comments

రాజన్న సిరిసిల్ల జిల్లాలో పంటల సాగుకు అవసరమైన మేర ఎరువులు అందుబాటులో ఉన్నాయి: కలెక్టర్

Original — Telugu

రాజన్న సిరిసిల్ల జిల్లాలో పంటల సాగుకు అవసరమైన మేర ఎరువులు అందుబాటులో ఉన్నాయని జిల్లా కలెక్టర్ గరీమ అగర్వాల్ పేర్కొన్నారు. జిల్లాలో ఎలాంటి ఎరువుల కొరత లేదని, రైతులు ఆందోళనకు గురి కావద్దని సూచించారు.

English · AI translation

Collector Garima Agarwal said that sufficient fertilizers are available for crop cultivation in Rajanna Sircilla district. She stated that there is no fertilizer shortage in the district and advised farmers not to worry.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is no fertilizer shortage in Rajanna Sircilla district and sufficient fertilizers are available for crop cultivation.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2133ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention c546b6fc · raw item 8a74dd32 · origin live

YouTubeJCB WARGALDealer86%30 Jun, 15:16 IST
Siddipet · wargal (96% conf.)Telugustance: neutral1,114 views · 6 likes · 0 comments

వర్గల్, ములుగు, సిద్దిపేట ప్రాంతాలకు పేడ ఎరువు డెలివరీ చేస్తాము

Original — Telugu

వర్గల్, ములుగు, సిద్దిపేట ప్రాంతాలకు పేడ ఎరువు డెలివరీ చేస్తాము

English · AI translation

We deliver manure to the Wargal, Mulugu, and Siddipet areas.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content says manure delivery is available to the Wargal, Mulugu, and Siddipet areas.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2129ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 888c282f · raw item 20fbf66a · origin live

YouTubeSwatantra TV Media organisation91%29 Jun, 19:47 IST
Rajanna Sircilla (97% conf.)Telugu / Englishstance: neutral178 views · 1 likes · 0 comments
Was live

సిరిసిల్లలో రైతుల ఆందోళన..|| Rajanna Sircilla fertilizer issue || Swatantra Tv

Original — Telugu / English

For more Latest News Updates: Contact:- swatantranewschannel@gmail.com

Show full source text as published

సిరిసిల్లలో రైతుల ఆందోళన..|| Rajanna Sircilla fertilizer issue || Swatantra Tv సిరిసిల్లలో రైతుల ఆందోళన..|| Rajanna Sircilla fertilizer issue || Swatantra Tv #FarmersProtest #Telangana #Sircilla #AgricultureCrisis #UreaShortage #BreakingNews #swatantratv Welcome to Swatantra News, your trusted Telugu satellite news channel. Stay informed with comprehensive coverage of regional, national, and international news. Our unbiased journalism brings you accurate updates on politics, business, As a popular satellite channel, we bring you the latest updates, news, and engaging content from the world of news. Explore in-depth coverage, exclusive interviews, behind-the-scenes glimpses, and reviews of the latest News. Join us for a News journey filled with entertainment, insights, and everything you need to know about the fascinating world of News Subscribe now and stay connected with all the buzz! For more Latest News Updates: Swatantra Tv Website : https://bit.ly/3CfRHbx Like Swatantra Tv On Facebook : https://bit.ly/3CfrFVY Follow Swatantra Tv on Twitter : https://bit.ly/3Tjwww6 Follow Swatantra Tv on Instagram : https://bit.ly/3CXrhg9 Contact:- swatantranewschannel@gmail.com

English · AI translation

Farmers' protest in Siricilla..|| Rajanna Sircilla fertilizer issue || Swatantra TV For more latest news updates: Contact:- swatantranewschannel@gmail.com

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are protesting in Sircilla over a fertilizer issue.” · confidence 88%

Sentiment: negativeStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1874ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:01
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 4148e68e · raw item 275038a0 · origin live

YouTubejv bazarDealer88%29 Jun, 16:01 IST
Mahabubabad (97% conf.)Englishstance: neutral36 views · 0 likes · 0 comments

KISAAN AGRI MALL#MAHABUBABAD FERTILIZERS/PESTICIDES

Original — English

KISAAN AGRI MALL#MAHABUBABAD PESTICIDES

fertilizer-availabilityinput-costpest-outbreak
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“KISAAN AGRI MALL is in Mahabubabad and deals with fertilizers/pesticides.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 88%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2251ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:39
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:40
  3. ENRICHED · 10 Sept, 19:41
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 10 Sept, 19:46
  7. NARRATIVE_ASSIGNED · 10 Sept, 19:46
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  19. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 6e04148b · raw item 325716ff · origin live

YouTubeT News teluguMedia organisation96%27 Jun, 16:53 IST
Nagarkurnool (95% conf.)Englishstance: critical1,012 views · 2 likes · 0 comments
Was live

Fertilizer Shortage & Rain Issues | Nagarkurnool Farmers Trouble Under Congress Govt & Revanth Rule

Original — English

Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now! For advertisement Contact - 9553955388 / 9553955409 Mail - advt@tnewslive.com

Show full source text as published

Fertilizer Shortage & Rain Issues | Nagarkurnool Farmers Trouble Under Congress Govt & Revanth Rule Fertilizer Shortage & Rain Issues | Nagarkurnool Farmers Trouble Under Congress Govt & Revanth Rule #Telugu #TnewsLive #Telangana Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now! For advertisement Contact - 9553955388 / 9553955409 Mail - advt@tnewslive.com Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://www.youtube.com/watch?v=ANU5_XHW2wA ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

fertilizer-availabilityrainfall
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Nagarkurnool farmers are facing fertilizer shortage and rain-related problems under the Congress government and Revanth rule.” · confidence 91%

Sentiment: negativeStance toward government: criticalTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1665ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:41
  3. ENRICHED · 10 Sept, 19:43
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 10 Sept, 19:45
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:41
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 02:28
  14. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  15. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  16. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  17. NARRATIVE_ASSIGNED · 15 Sept, 14:38
  18. NARRATIVE_ASSIGNED · 15 Sept, 19:53
  19. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  20. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  21. NARRATIVE_ASSIGNED · 17 Sept, 00:03
  22. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  23. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  24. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  25. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  26. NARRATIVE_ASSIGNED · 22 Sept, 09:14
  27. NARRATIVE_ASSIGNED · 22 Sept, 14:24
  28. NARRATIVE_ASSIGNED · 22 Sept, 19:37
  29. NARRATIVE_ASSIGNED · 23 Sept, 02:36
  30. NARRATIVE_ASSIGNED · 23 Sept, 07:30
  31. NARRATIVE_ASSIGNED · 23 Sept, 18:32

mention 5a0a55e0 · raw item a97c07a9 · origin live

YouTubeDAR FOCUS NelloreMedia organisation72%27 Jun, 14:33 IST
District not evidencedEnglishstance: supportive61,519 views · 99 likes · 0 comments

Good News for Telangana Farmers - Fertilizers Ready for Kharif Season | Latest updates | DAR FOCUS

Original — English

LINK: Union Minister **G. Kishan Reddy** has stated that the Central Government has ensured an adequate supply of fertilizers for farmers in Telangana ahead of the **Kharif season**. According to the Minister, sufficient stocks of essential fertilizers have been made available to meet agricultural demand, helping farmers carry out sowing activities without shortages. The move is aimed at supporting timely cultivation and ensuring smooth agricultural operations during the Kharif season. DAR FOCUS is an official YouTube Channel that will constantly keep you updated with the latest breaking news, trending topics, entertainment videos ,exclusive Interviews, health and beauty tips, numerology tips, and others. Stay updated with Tollywood's latest happenings and other social media viral news exclusively on DAR FOCUS Channel.Wild Wolf Digital is stepping ahead of other brands on YouTube with its variety of unique content delivering strategies, including interviews in entertainment and political backdrop. DAR FOCUS is now all set to enlighten and entertain its viewers with exclusives interviews and celebrity interviews. So never miss an update from DAR FOCUSby subscribing to our channel. Filmy Monk is always at the forefront in providing its users with a variety of content through interview which will be taken by produced by experienced and content-driven. Never miss an update about DAR FOCUS programs by subscribing to the channel.

Show full source text as published

Good News for Telangana Farmers - Fertilizers Ready for Kharif Season | Latest updates | DAR FOCUS Good News for Telangana Farmers - Fertilizers Ready for Kharif Season | Latest updates | DAR FOCUS LINK: 🌾 Good News for Telangana Farmers! Union Minister **G. Kishan Reddy** has stated that the Central Government has ensured an adequate supply of fertilizers for farmers in Telangana ahead of the **Kharif season**. According to the Minister, sufficient stocks of essential fertilizers have been made available to meet agricultural demand, helping farmers carry out sowing activities without shortages. The move is aimed at supporting timely cultivation and ensuring smooth agricultural operations during the Kharif season. Kharif Season Fertilizers, Telangana Farmers News, Kishan Reddy Statement, Fertilizer Supply India, Agriculture Inputs India, Fertilizer Availability Telangana, Central Government Farmers Support, Kharif Crop Season India, DAP Urea Supply India, Farmers Welfare Scheme, Agriculture News Telangana, India Fertilizer Policy, Farming Inputs Update, Crop Season Preparation India, Government Agriculture Support, Telangana Latest News, Farmer Fertilizer Supply, Indian Agriculture News, Rural Development India, Latest Government News #Telangana #KharifSeason #Farmers #Fertilizers #Agriculture #KishanReddy #FarmerSupport #AgricultureNews #GovernmentUpdate #FarmerBenefits #TSNews #CropSeason #BreakingNews #IndiaAgriculture #YouTubeShorts DAR FOCUS is an official YouTube Channel that will constantly keep you updated with the latest breaking news, trending topics, entertainment videos ,exclusive Interviews, health and beauty tips, numerology tips, and others. Stay updated with Tollywood's latest happenings and other social media viral news exclusively on DAR FOCUS Channel.Wild Wolf Digital is stepping ahead of other brands on YouTube with its variety of unique content delivering strategies, including interviews in entertainment and political backdrop. DAR FOCUS is now all set to enlighten and entertain its viewers with exclusives interviews and celebrity interviews. So never miss an update from DAR FOCUSby subscribing to our channel. Filmy Monk is always at the forefront in providing its users with a variety of content through interview which will be taken by produced by experienced and content-driven. Never miss an update about DAR FOCUS programs by subscribing to the channel. #DARFOCUSChannel #DARFOCUSAnalysis#DARFOCUSConstituencies#DARFOCUSPolitics #DARFOCUSChannelLive

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The Central Government has ensured an adequate supply of fertilizers for farmers in Telangana ahead of the Kharif season.” · confidence 92%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 97%Agriculture relevance: 88%Classification confidence: 89%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1553ms)

Processing trail
  1. NORMALIZED · 8 Sept, 11:21
  2. RELEVANCE_ACCEPTED · 8 Sept, 11:25
  3. ENRICHED · 8 Sept, 11:33
  4. DEDUPED · 8 Sept, 11:35
  5. NARRATIVE_ASSIGNED · 8 Sept, 11:35
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f6d8e2ff · raw item c0c67f71 · origin live

YouTubeBRK AgricultureMedia organisation91%24 Jun, 15:34 IST
Mulugu (98% conf.)Telugustance: neutral171 views · 0 likes · 0 comments

ములుగులో ఎరువుల దుకాణాలపై ఆకస్మిక తనిఖీలు | అక్రమాలకు పాల్పడితే కఠిన చర్యలు: డీఎస్పీ కిషోర్ బాబు

Original — Telugu

ములుగులో ఎరువుల దుకాణాలపై ఆకస్మిక తనిఖీలు | అక్రమాలకు పాల్పడితే కఠిన చర్యలు: డీఎస్పీ కిషోర్ బాబు

Show full source text as published

ములుగులో ఎరువుల దుకాణాలపై ఆకస్మిక తనిఖీలు | అక్రమాలకు పాల్పడితే కఠిన చర్యలు: డీఎస్పీ కిషోర్ బాబు #mulugu #FertilizerShops #DSPKishoreBabu #MuluguPolice #agriculturenews #FarmersNews #TeluguNews #BreakingNews #LatestNews #FakeFertilizers

English · AI translation

Sudden inspections of fertilizer shops in Mulugu | Strict action if illegal activities are carried out: DSP Kishore Babu

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Sudden inspections were conducted at fertilizer shops in Mulugu.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1845ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention d32d6f96 · raw item 33fc68a0 · origin live

YouTubeDAR FOCUS NelloreMedia organisation72%23 Jun, 20:11 IST
District not evidencedEnglishstance: neutral16,754 views · 48 likes · 0 comments

Telangana Introduces New ‘Mandal-Level Unit’ System in Fertilizer Booking App | DAR FOCUS

Original — English

LINK: The Telangana Government has decided to introduce a new *“Mandal-Level Unit”* system in the fertilizer booking app to improve the distribution and availability of fertilizers for farmers. The new system is expected to streamline the booking process, enhance transparency, and ensure that fertilizers are supplied more efficiently at the local level. By adopting the mandal-based approach, the government aims to reduce delays and make fertilizer allocation more organized during the agricultural season. Farmers are advised to stay updated with official announcements regarding the implementation process and any changes in booking procedures. DAR FOCUS is an official YouTube Channel that will constantly keep you updated with the latest breaking news, trending topics, entertainment videos ,exclusive Interviews, health and beauty tips, numerology tips, and others. Stay updated with Tollywood's latest happenings and other social media viral news exclusively on DAR FOCUS Channel.Wild Wolf Digital is stepping ahead of other brands on YouTube with its variety of unique content delivering strategies, including interviews in entertainment and political backdrop. DAR FOCUS is now all set to enlighten and entertain its viewers with exclusives interviews and celebrity interviews. So never miss an update from DAR FOCUSby subscribing to our channel. Filmy Monk is always at the forefront in providing its users with a variety of content through interview which will be taken by produced by experienced and content-driven. Never miss an update about DAR FOCUS programs by subscribing to the channel.

Show full source text as published

Telangana Introduces New ‘Mandal-Level Unit’ System in Fertilizer Booking App | DAR FOCUS Telangana Introduces New ‘Mandal-Level Unit’ System in Fertilizer Booking App | DAR FOCUS LINK: 🌾 Telangana Fertilizer Booking App Gets Major Update! The Telangana Government has decided to introduce a new *“Mandal-Level Unit”* system in the fertilizer booking app to improve the distribution and availability of fertilizers for farmers. The new system is expected to streamline the booking process, enhance transparency, and ensure that fertilizers are supplied more efficiently at the local level. By adopting the mandal-based approach, the government aims to reduce delays and make fertilizer allocation more organized during the agricultural season. Farmers are advised to stay updated with official announcements regarding the implementation process and any changes in booking procedures. Telangana Fertilizer Booking App, Telangana Agriculture News, Fertilizer Booking System, Mandal Level Unit System, Telangana Farmers Update, Agriculture Department Telangana, Fertilizer Distribution Update, Telangana Government Scheme, Farmer Services App, Agriculture Technology Update, Telangana Farming News, Fertilizer Management System, Farmer Welfare Telangana, Agri App Update, Telangana Rural Development, Agriculture Reforms, Fertilizer Supply News, Telangana Latest News, Farming Technology India, Farmer Support Services #Telangana #FertilizerBooking #Farmers #AgricultureNews #TelanganaFarmers #FertilizerApp #GovernmentUpdate #AgricultureUpdate #FarmerWelfare #FarmingNews #TelanganaGovernment #AgriTech #CropSeason #RythuNews #YouTubeShorts DAR FOCUS is an official YouTube Channel that will constantly keep you updated with the latest breaking news, trending topics, entertainment videos ,exclusive Interviews, health and beauty tips, numerology tips, and others. Stay updated with Tollywood's latest happenings and other social media viral news exclusively on DAR FOCUS Channel.Wild Wolf Digital is stepping ahead of other brands on YouTube with its variety of unique content delivering strategies, including interviews in entertainment and political backdrop. DAR FOCUS is now all set to enlighten and entertain its viewers with exclusives interviews and celebrity interviews. So never miss an update from DAR FOCUSby subscribing to our channel. Filmy Monk is always at the forefront in providing its users with a variety of content through interview which will be taken by produced by experienced and content-driven. Never miss an update about DAR FOCUS programs by subscribing to the channel. #DARFOCUSChannel #DARFOCUSAnalysis#DARFOCUSConstituencies#DARFOCUSPolitics #DARFOCUSChannelLive

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Telangana Government has decided to introduce a new Mandal-Level Unit system in the fertilizer booking app.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 96%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2684ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:58
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 43978812 · raw item d33a5914 · origin live

YouTubeRTV NizamabadMedia organisation99%23 Jun, 18:22 IST
Nizamabad (98% conf.)Telugustance: neutral114 views · 1 likes · 0 comments

ఇలా చేస్తే ఇంటికే ఎరువులు | Nizamabad Collector Ila Tripathi | RTV

Original — Telugu

ఇలా చేస్తే ఇంటికే ఎరువులు | Nizamabad Collector Ila Tripathi | RTV

Show full source text as published

ఇలా చేస్తే ఇంటికే ఎరువులు | Nizamabad Collector Ila Tripathi | RTV ఇలా చేస్తే ఇంటికే ఎరువులు | Nizamabad Collector Ila Tripathi | RTV #rtvnizamabad #latestnews #nizamabadupdates ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

If done like this, fertilizers will be delivered to the home | Nizamabad Collector Ila Tripathi | RTV

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content refers to fertilizer being delivered to homes in Nizamabad.” · confidence 72%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 85%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2342ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:40
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 8df071e4 · raw item d3fb1f74 · origin live

YouTubeRaythu nestham Unclassified16 Jun, 22:19 IST
Mahabubabad (98% conf.)Englishstance: neutral85 views · 2 likes · 0 comments

Sri Ramkrishna seeds fertilizer and pesticides mahabubabad 9700083430

Original — English

Sri Ramkrishna seeds fertilizer and pesticides mahabubabad 9700083430

seedsfertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Sri Ramkrishna Seeds, Fertilizer and Pesticides is in Mahabubabad.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 96%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1775ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:39
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:40
  3. ENRICHED · 10 Sept, 19:41
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  20. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 4fc233c8 · raw item 96a77f12 · origin live

YouTubecluetoday newsMedia organisation96%16 Jun, 20:24 IST
Vikarabad (98% conf.)Telugustance: neutral21 views · 0 likes · 0 comments

CLUE TODAY NEWS//ఎరువులు, డీలర్ల లైసె న్సులు చేస్తామని వికారాబాద్ జిల్లా కలెక్టర్ దీపక్ తివారి

Original — Telugu

CLUE TODAY NEWS//ఎరువులు, డీలర్ల లైసె న్సులు చేస్తామని వికారాబాద్ జిల్లా కలెక్టర్ దీపక్ తివారి

English · AI translation

CLUE TODAY NEWS// Vikarabad District Collector Deepak Tiwari said that fertilizer dealers' licenses will be issued.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Vikarabad district collector Deepak Tiwari said that fertilizer dealers' licenses will be issued.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 80%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1364ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 44b7f9fd · raw item 9fa25c2a · origin live

YouTubeCVR News TeluguMedia organisation96%14 Jun, 06:54 IST
Nizamabad (98% conf.)Englishstance: neutral186 views · 0 likes · 0 comments
Was live

నిజామాబాదు జిల్లాలో ఎరువుల కొరత | Fertilizer Shortage In Nizamabad District | CVR News

Original — English

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

నిజామాబాదు జిల్లాలో ఎరువుల కొరత | Fertilizer Shortage In Nizamabad District | CVR News #fertilizers #nizamabaddistrict #breakingnews #cvrnews నిజామాబాదు జిల్లాలో ఎరువుల కొరత | Fertilizer Shortage In Nizamabad District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer shortage in Nizamabad district.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2159ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:57
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:01
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 0741ec5b · raw item 26d3fef5 · origin live

YouTubeK6 NIZAMABADMedia organisation99%13 Jun, 13:30 IST
Nizamabad (99% conf.)Telugustance: neutral558 views · 3 likes · 0 comments

నిజామాబాద్ నగరానికి చేరుకున్న ఎరువుల వ్యాగన్ గూడ్స్ రైలు || K6 NEWS 13-06-2026 ||

Original — Telugu

నిజామాబాద్ నగరానికి చేరుకున్న ఎరువుల వ్యాగన్ గూడ్స్ రైలు || K6 NEWS 13-06-2026 ||

Show full source text as published

నిజామాబాద్ నగరానికి చేరుకున్న ఎరువుల వ్యాగన్ గూడ్స్ రైలు || K6 NEWS 13-06-2026 || నిజామాబాద్ నగరానికి చేరుకున్న ఎరువుల వ్యాగన్ గూడ్స్ రైలు || K6 NEWS 13-06-2026 ||

English · AI translation

The fertilizer goods train wagon has arrived in Nizamabad city || K6 NEWS 13-06-2026 ||

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A fertilizer goods wagon train reached Nizamabad city.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2300ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:40
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 59e37edd · raw item c0e38501 · origin live

YouTubeV6 News TeluguMedia organisation99%12 Jun, 15:37 IST
Nizamabad (98% conf.)Telugu / Englishstance: neutral251 views · 1 likes · 0 comments

Rythu Commission Member Gangadhar Inspects Fertilizer Shops In Nizamabad | V6 News

Original — Telugu / English

Watch Teenmaar Full Episode రావాల్సినయ్ కావాల్సినయ్ కవితక్కకు TRS పరేషాన్ ఈసీకి 700 కంప్లేంట్లు... కాంగ్రెస్ వచ్చాకే విద్వేషాలా..? ఏం వండాలే..ఏం తినాలే ప్రాణాలు మింగిన పండ్లు ఆంధ్రాకు ఫండ్ మనకు పెండింగ్ గల్లీ నుంచి ఢిల్లీ దాకా.. చికెన్ వేస్టేజ్ చేపలకు.. పెద్ద స్కామ్..18 రోజుల్లో ఖతం Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News"

Show full source text as published

Rythu Commission Member Gangadhar Inspects Fertilizer Shops In Nizamabad | V6 News Rythu Commission Member Gangadhar Inspects Fertilizer Shops In Nizamabad | V6 News Watch Teenmaar Full Episode https://youtu.be/YuUd6o_U2Oo రావాల్సినయ్ కావాల్సినయ్ https://youtu.be/zIABmvJ3-6o కవితక్కకు TRS పరేషాన్ ఈసీకి 700 కంప్లేంట్లు... https://youtu.be/Sso3kGiwcoc కాంగ్రెస్ వచ్చాకే విద్వేషాలా..? https://youtu.be/OIPbJPDKQuY ఏం వండాలే..ఏం తినాలే https://youtu.be/fRY5tV0r2Rg ప్రాణాలు మింగిన పండ్లు https://youtu.be/R0XLObcN_Mw ఆంధ్రాకు ఫండ్ మనకు పెండింగ్ https://youtu.be/lAeua4Okxy8 గల్లీ నుంచి ఢిల్లీ దాకా.. https://youtu.be/aEROKQeux6s చికెన్ వేస్టేజ్ చేపలకు.. https://youtu.be/_b7d_bjpaqQ పెద్ద స్కామ్..18 రోజుల్లో ఖతం https://youtu.be/WN_w2PN_i50 Watch LIVE Stream : https://www.youtube.com/watch?v=nrb8P8shbDk ► Subscribe to V6 News : https://www.youtube.com/c/V6NewsTelugu ► Subscribe to V6 Life : https://www.youtube.com/c/V6Life ► Follow Us On Dailymotion : https://www.dailymotion.com/v6newstelugu ► Like us on Facebook : http://www.facebook.com/V6News.tv ► Follow us on Instagram : https://www.instagram.com/v6newstelugu/ ► Follow us on Twitter : https://twitter.com/V6News ► Visit Website : http://www.v6velugu.com/ ► Join Us On Telegram : https://t.me/V6NewsTelugu Watch V6 Programs Here ►Teenmaar : https://rb.gy/qn91pg ►Trending Videos : https://rb.gy/f6i0x2 ►Top News : https://rb.gy/wqjeun ►HD Playlist : https://rb.gy/veit87 ►Innerview : https://rb.gy/83izwa ►Medaram Jatara : https://rb.gy/mn4tu7 ►Chandravva : https://rb.gy/nja3cl ►Spotlight : https://rb.gy/4lfm9s ►Dhoom Thadaka : https://rb.gy/hvytxl ►V6 Songs : https://rb.gy/68n90s ►Life Mates : https://rb.gy/itvwfa News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News" #rythucommission #fakeseeds #ureacrisis #V6News #V6 #V6Velugu #TelanganaNews #Telangana

English · AI translation

Rythu Commission Member Gangadhar Inspects Fertilizer Shops In Nizamabad | V6 News Watch Teenmaar Full Episode V6 News channel also airs programs like Teenmaar News, Chandravva & Padma satires, Theertham, Muchata (celebrity interviews), Cinema Talkies, City Nazaria (a program describing the most happening and visiting places in Hyderabad), Mana Palle (describes villages and their specialties), and is famous for Bonalu songs, Bathukamma songs, and other seasonal and folk-related songs. "V6 Teenmaar News", "Teenmaar News"

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Rythu Commission Member Gangadhar inspects fertilizer shops in Nizamabad.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 5667ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:57
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:59
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention c124cb60 · raw item 2d868ca1 · origin live

YouTubeanandraj kumarCitizen66%11 Jun, 18:32 IST
Nirmal (98% conf.)Telugustance: critical10 views · 0 likes · 0 comments

రైతులకు ఉచితంగా ఎరువులు విత్తనాలు ఇవ్వాలి నిర్మల్ జిల్లాలోని AiKMS ఆధ్వర్యంలో ధర్నా

Original — Telugu

రైతులకు ఉచితంగా ఎరువులు విత్తనాలు ఇవ్వాలి నిర్మల్ జిల్లాలోని AiKMS ఆధ్వర్యంలో ధర్నా

English · AI translation

Free fertilizers and seeds should be given to farmers; a dharna under the leadership of AiKMS in Nirmal district.

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A dharna was held in Nirmal district under the leadership of AiKMS demanding free fertilizers and seeds for farmers.” · confidence 97%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 96%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3369ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention fcf7212f · raw item 12c24870 · origin live

XAgriculture INDIA@AgriGoIMedia organisation74%10 Jun, 22:26 IST
Jogulamba Gadwal (99% conf.)Englishstance: neutral1,325 views · 32 likes · 15 reposts · 2 comments
Original — English

An awareness programme under #KhetBachaoAbhiyan was conducted in Gadwal District, Telangana. The sessions focused on Khet Bachao programme, impact of El Niño on cropping systems, balanced use of fertilizers, Natural Farming, Nano Urea, Nano DAP, and the Farmer Registry.

fertilizer-availabilityfarm-mechanisation
Open original source ↗
AI interpretation & provenance
Extracted claim

“An awareness programme under #KhetBachaoAbhiyan was conducted in Gadwal District, Telangana.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1760ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:22
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:43
  3. ENRICHED · 30 Aug, 01:03
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:25
  6. ENRICHED · 8 Sept, 01:37
  7. DEDUPED · 8 Sept, 02:08
  8. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:20
  10. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  11. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  12. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  14. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  15. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  16. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  17. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  18. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  19. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  20. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  21. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 312f9bce · raw item 52c4906d · origin live

YouTube99TV TeluguMedia organisation99%10 Jun, 21:20 IST
Nizamabad (99% conf.)Telugustance: neutral49 views · 1 likes · 0 comments

నిజామాబాద్ ఎడపల్లిలో కలెక్టర్ త్రిపాఠి సింగిల్ విండో & ఎరువుల దుకాణాల తనిఖీ! | Nizamabad | 99TV

Original — Telugu

నిజామాబాద్ ఎడపల్లిలో కలెక్టర్ త్రిపాఠి సింగిల్ విండో & ఎరువుల దుకాణాల తనిఖీ! | Nizamabad | 99TV

Show full source text as published

నిజామాబాద్ ఎడపల్లిలో కలెక్టర్ త్రిపాఠి సింగిల్ విండో & ఎరువుల దుకాణాల తనిఖీ! | Nizamabad | 99TV #nizamabad #collectortripati #99tv నిజామాబాద్ ఎడపల్లిలో కలెక్టర్ త్రిపాఠి సింగిల్ విండో & ఎరువుల దుకాణాల తనిఖీ! | Nizamabad | 99TV ► Subscribe to 99TV Telugu: https://bit.ly/37DMKbn Follow us on Telegram ► https://t.me/news99tv Join in Our 99 TV Whatsapp Group ► https://chat.whatsapp.com/K09r7OrXJFI2AMkiliyGpd The news of 99TV Telugu is daring, straightforward and biased only towards people. Using its unparalleled infrastructure, 99TV Telugu has brought shows that were unprecedented in its genre. As a pioneer in infotainment, it has launched a series of game shows and interactive content. Its hard-hitting news, frank questioning and result oriented analysis driven by its in-depth journalism have made it the agenda setter for the Telugu people. ►Subscribe to 99tv Telugu: https://www.youtube.com/99tvtelugu?sub_confirmation=1 ►Like us on Facebook: https://www.facebook.com/99tvtelugu ► Follow us on Twitter: https://twitter.com/99tvtelugu ► https://www.instagram.com/99tvtelugu/ ► https://plus.google.com/u/0/+99TVTelugu

English · AI translation

Collector Tripathi inspected the single-window and fertilizer shops in Edapalli, Nizamabad! | Nizamabad | 99TV

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Collector Tripathi inspected single-window and fertilizer shops in Edapalli, Nizamabad.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1913ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 033ce2d1 · raw item e2e1b3b6 · origin live

YouTubeTV9 Telugu LiveMedia organisation99%7 Jun, 08:33 IST
Nizamabad (98% conf.)Telugu / Englishstance: neutral1,091 views · 7 likes · 1 comments

Fertilizer Shortage in Nizamabad : ఖరీఫ్ ప్రారంభంలోనే ఎరువుల కష్టాలు - TV9

Original — Telugu / English

Follow TV9 Telugu on Social Media: Credits : #vishwagajagouni

Show full source text as published

Fertilizer Shortage in Nizamabad : ఖరీఫ్ ప్రారంభంలోనే ఎరువుల కష్టాలు - TV9 Fertilizer Shortage in Nizamabad : ఖరీఫ్ ప్రారంభంలోనే ఎరువుల కష్టాలు - TV9 🔔 Subscribe to TV9 Telugu & press the Bell Icon for breaking news alerts. 👍 Like | Comment | Share Follow TV9 Telugu on Social Media: ► TV9 News App : https://onelink.to/de8b7y ► తాజా వార్తల కోసం : https://tv9telugu.com/ ► Follow us on X : https://twitter.com/Tv9Telugu ► Like us on Facebook: https://www.facebook.com/tv9telugu ► Follow us on Instagram: https://www.instagram.com/tv9telugu ► Follow us on Threads: https://www.threads.net/@tv9telugu ► Follow us on WhatsApp: https://whatsapp.com/channel/0029VaARkBWBFLgLrGrDcX3N #Nizamabad #KharifSeason #FertilizerShortage #Farmers #AgricultureNews #TelanganaNews #BreakingNews #TeluguNews #Fertilizers #FarmerIssues #LatestNews #tv9telugu Credits : #vishwagajagouni

English · AI translation

Fertilizer Shortage in Nizamabad: Fertilizer difficulties at the start of the kharif season - TV9

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer shortage in Nizamabad at the start of the kharif season.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 95%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2401ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:57
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:01
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 148b8496 · raw item f7042ebf · origin live

YouTubeETV TelanganaMedia organisation96%6 Jun, 15:24 IST
Mahabubnagar (96% conf.)Englishstance: neutral2,401 views · 18 likes · 0 comments

Kharif Season Preparations Begin as Rains Expected Soon | Agriculture Officer Venkatesh Interview

Original — English

With the Kharif season approaching, farmers across Mahabubnagar district are preparing their fields for cultivation. Following forecasts from the Meteorological Department indicating rainfall within the next few days, farmers have started clearing crop residues and getting their lands ready for sowing. In this special interview, Mahabubnagar District Agriculture Officer Venkatesh discusses the department's plans for the Kharif season, availability of quality seeds and fertilizers, crop recommendations, and measures being taken to support farmers. Watch the full discussion for important updates and guidance for the upcoming agricultural season. ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. For More Latest Political and News Updates :

Show full source text as published

Kharif Season Preparations Begin as Rains Expected Soon | Agriculture Officer Venkatesh Interview With the Kharif season approaching, farmers across Mahabubnagar district are preparing their fields for cultivation. Following forecasts from the Meteorological Department indicating rainfall within the next few days, farmers have started clearing crop residues and getting their lands ready for sowing. In this special interview, Mahabubnagar District Agriculture Officer Venkatesh discusses the department's plans for the Kharif season, availability of quality seeds and fertilizers, crop recommendations, and measures being taken to support farmers. Watch the full discussion for important updates and guidance for the upcoming agricultural season. #tgspecial #Kharif2026 #KharifSeason #Mahabubnagar #Farmers #Agriculture #TelanganaFarmers #Monsoon2026 #FarmingNews #AgricultureDepartment #Seeds #Fertilizers ------------------------------------------------------------------------------------------------------------- #latestnewstelugutoday #etvtelanganalive #latestnewsupdate ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. WATCH ETV TELANGANA LIVE HERE: https://tinyurl.com/uvbvdx9x For More Latest Political and News Updates : SUBSCRIBE ► ETV Telangana : https://shorturl.at/lK94S #etvtelanganalive #BreakingNews #TrendingNews #LiveUpdates #LatestNews #ViralNews ETV Telangana Live is a 24/7 Telugu news television channel in Telangana and is a part of ETV Network dedicated to the Latest Political News, Live Reports, Exclusive Interviews, Breaking News, Sports News, Weather Updates, Entertainment, Business, and Current Affairs. ► Watch LIVE: https://bit.ly/3Orz2jn ► For Latest News : http://www.ts.etv.co.in ► Follow us on WhatsApp: https://whatsapp.com/channel/0029Va8RS5O2ER6coKrig41U ► Follow us on X : https://twitter.com/etvtelangana ► Follow us on Instagram : https://www.instagram.com/etvtelangana ► Subscribe to ETV Telangana : https://bit.ly/4ihMVyy ► Like us on Facebook: https://www.facebook.com/ETVTelangana ► Follow us on Threads: https://www.threads.net/@etvandhrapradesh ► ETV Telangana News App : https://f66tr.app.goo.gl/apps ►ETV Win Website : https://www.etvwin.com/ #etvtelangana #etvtelanganalive #EtvTelanganaNews #livenews #latestnews #etvandhrapradeshlive #TeluguNews #latestnews #latestnewstoday #latestnewsupdate #latestnewstelugutoday #latestnewstelugu

rainfallseedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers across Mahabubnagar district are preparing their fields for Kharif cultivation ahead of expected rainfall in the next few days.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 94%Agriculture relevance: 98%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3190ms)

Processing trail
  1. NORMALIZED · 15 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 15 Sept, 19:43
  3. ENRICHED · 15 Sept, 19:52
  4. DEDUPED · 15 Sept, 19:52
  5. NARRATIVE_ASSIGNED · 15 Sept, 19:53
  6. NARRATIVE_ASSIGNED · 15 Sept, 19:53
  7. NARRATIVE_ASSIGNED · 15 Sept, 19:53
  8. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  9. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  10. NARRATIVE_ASSIGNED · 17 Sept, 00:03
  11. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  12. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  13. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  14. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  15. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  16. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  18. NARRATIVE_ASSIGNED · 22 Sept, 09:14
  19. NARRATIVE_ASSIGNED · 22 Sept, 14:24
  20. NARRATIVE_ASSIGNED · 22 Sept, 19:37
  21. NARRATIVE_ASSIGNED · 23 Sept, 02:36
  22. NARRATIVE_ASSIGNED · 23 Sept, 07:30
  23. NARRATIVE_ASSIGNED · 23 Sept, 18:32

mention 028f591f · raw item cb221176 · origin live

YouTubeIFFCO TelanganaMedia organisation86%5 Jun, 17:33 IST
Nalgonda (98% conf.)Telugustance: neutral1 views · 0 likes · 0 comments

నల్గొండ జిల్లా రైతు మహేష్ గారి వరి పంటలో నానో ఎరువుల అనుభవం

Original — Telugu

నల్గొండ జిల్లా రైతు మహేష్ గారి వరి పంటలో నానో ఎరువుల అనుభవం

English · AI translation

Farmer Mahesh's experience with nano fertilizers in his paddy crop in Nalgonda district.

fertilizer-availabilitypaddy
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmer Mahesh from Nalgonda district has experience using nano fertilizers in his paddy crop.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2350ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention f85f2b32 · raw item 69c20de9 · origin live

YouTubeDD NEWS TelanganaMedia organisation99%4 Jun, 14:15 IST
Peddapalli (78% conf.)Telugu / Englishstance: neutral196 views · 2 likes · 0 comments

Ramagundam Fertilizer Plant Sets New Production Record in May

Original — Telugu / English

రామగుండం ఎరువుల కర్మాగారం రికార్డు స్థాయిలో ఎరువులను ఉత్పత్తి చేసింది. గడచిన మే నెలలో లక్షా 7 వేల 883 మెట్రిక్ టన్నుల ఎరువులను ఉత్పత్తి చేసినట్లు అధికారులు ప్రకటించారు. తెలంగాణతో పాటు ఆంధ్రప్రదేశ్, కర్ణాటక, తమిళనాడు, మహారాష్ట్ర, ఛత్తీస్ ఘడ్ రాష్ట్రాలకు రికార్డు స్థాయిలో ఎరువులను సరఫరా చేశామన్నారు. మే నెలలో రాష్ట్రానికి 64వేల 229.15 మెట్రిక్ టన్నులు సరఫారా చేసినట్టు వెల్లడించారు. రానున్న యాసంగి పంటకు ఆయా రాష్ట్రాలలో ఎరువుల కొరత లేకుండా చర్యలు తీసుకుంటున్నట్టు తెలిపారు. మరిన్ని వివరాలు మా ప్రతినిధి మధుకర్ అందిస్తారు. Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms:

Show full source text as published

Ramagundam Fertilizer Plant Sets New Production Record in May రామగుండం ఎరువుల కర్మాగారం రికార్డు స్థాయిలో ఎరువులను ఉత్పత్తి చేసింది. గడచిన మే నెలలో లక్షా 7 వేల 883 మెట్రిక్ టన్నుల ఎరువులను ఉత్పత్తి చేసినట్లు అధికారులు ప్రకటించారు. తెలంగాణతో పాటు ఆంధ్రప్రదేశ్, కర్ణాటక, తమిళనాడు, మహారాష్ట్ర, ఛత్తీస్ ఘడ్ రాష్ట్రాలకు రికార్డు స్థాయిలో ఎరువులను సరఫరా చేశామన్నారు. మే నెలలో రాష్ట్రానికి 64వేల 229.15 మెట్రిక్ టన్నులు సరఫారా చేసినట్టు వెల్లడించారు. రానున్న యాసంగి పంటకు ఆయా రాష్ట్రాలలో ఎరువుల కొరత లేకుండా చర్యలు తీసుకుంటున్నట్టు తెలిపారు. మరిన్ని వివరాలు మా ప్రతినిధి మధుకర్ అందిస్తారు. Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms: YouTube: https://www.youtube.com/@ddnewstelangana Instagram: https://www.instagram.com/ddnewstelangana Twitter (X): https://x.com/ddyadagirinews Facebook: https://www.facebook.com/DDNewsHyderabad #DDNewsTelangana #TelanganaUpdates #HyderabadNews #LatestNews #PublicServiceBroadcasting #TeluguNews

English · AI translation

The Ramagundam fertilizer plant produced fertilizer at a record level. Officials said that in the past May month it produced 107,883 metric tons of fertilizer. They said fertilizer was supplied at record levels to Telangana as well as Andhra Pradesh, Karnataka, Tamil Nadu, Maharashtra, and Chhattisgarh. They revealed that 64,229.15 metric tons were supplied to the state in May. They stated that steps are being taken to ensure there is no fertilizer shortage in those states for the upcoming Yasangi crop. More details will be provided by our correspondent Madhukar.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The Ramagundam Fertilizer Plant produced 107,883 metric tons of fertilizer in May and supplied 64,229.15 metric tons to Telangana that month.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 98%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2615ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:35
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f19f0279 · raw item 01b76652 · origin live

YouTubeK6 NIZAMABADMedia organisation99%2 Jun, 12:08 IST
Nizamabad (86% conf.)Telugustance: neutral224 views · 1 likes · 0 comments

ఎరువుల కొరత లేకుండా చర్యలు #k6news #latestnews #viralvideo #viralshort #reels #news #newsupdate

Original — Telugu

ఎరువుల కొరత లేకుండా చర్యలు

Show full source text as published

ఎరువుల కొరత లేకుండా చర్యలు #k6news #latestnews #viralvideo #viralshort #reels #news #newsupdate ఎరువుల కొరత లేకుండా చర్యలు #k6news #latestnews #viralvideo #viralshort #reels #news #newsupdate

English · AI translation

Measures to ensure there is no shortage of fertilizers

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Measures are being taken to avoid a shortage of fertilizers.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 74%Agriculture relevance: 93%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3129ms)

Processing trail
  1. NORMALIZED · 8 Sept, 23:50
  2. RELEVANCE_ACCEPTED · 8 Sept, 23:51
  3. ENRICHED · 8 Sept, 23:52
  4. DEDUPED · 8 Sept, 23:55
  5. NARRATIVE_ASSIGNED · 8 Sept, 23:56
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 919b547f · raw item 3579b7f7 · origin live

YouTubeMic Tv NewsMedia organisation97%28 May, 03:08 IST
Siddipet · Chinnakodur (95% conf.)Telugustance: critical892 views · 12 likes · 0 comments
Was live

LIVE: Harish Rao LIVE | Inspects Rain-Soaked Grain at Chinnakodur Market Yard | BRS LIVE | Mic TV

Original — Telugu

LIVE: Harish Rao LIVE | Inspects Rain-Soaked Grain at Chinnakodur Market Yard, Siddipet | BRS LIVE | Mic TV News

Show full source text as published

LIVE: Harish Rao LIVE | Inspects Rain-Soaked Grain at Chinnakodur Market Yard | BRS LIVE | Mic TV LIVE: Harish Rao LIVE | Inspects Rain-Soaked Grain at Chinnakodur Market Yard, Siddipet | BRS LIVE | Mic TV News #harishrao #harishraolive #brslive #mictvnewslive Our Exclusive Interviews: https://www.youtube.com/playlist?list=PL87aAmTP1rS-MnSZXgyPUOjwnAAuXqUQX Subscribe to MicTv for more videos: http://bit.ly/2Ha0exW ► Like us on Facebook: https://www.facebook.com/MictvTeluguNews ► Follow us on Twitter: https://twitter.com/Mictvdigital ► Follow us on Instagram: https://instagram.com/MicTvin ►Follow us on whatsapp Channel : https://whatsapp.com/channel/0029Va9uEqTFMqrROLiFFh37 #MicTv.in is a Digital News platform for reporting and writing on various issues, producing videos with a specific focus on the #Telangana & Andhra Pradesh. Our content will include breaking news, detailed reporting ground reportage, news analysis and opinions. Located at #Hyderabad

English · AI translation

LIVE: Harish Rao LIVE | Inspects Rain-Soaked Grain at Chinnakodur Market Yard | BRS LIVE | Mic TV LIVE: Harish Rao LIVE | Inspects Rain-Soaked Grain at Chinnakodur Market Yard, Siddipet | BRS LIVE | Mic TV News The speaker says that both the state and central governments have failed in their responsibilities, causing farmers to suffer on the roads over procurement issues. He says the Congress government in power in the state is shifting blame to the Centre for not buying paddy, maize, sunflower, gram, and jowar, while Congress leaders are protesting to reduce petrol and diesel prices. He says the central government has not allotted the FCI levy quota to the state for maize, gram, jowar, and sunflower, and has not given fertilizer quota on time. He says that when BRS was in power under KCR, there were no problems with fertilizer or paddy procurement for ten years. He says procurement was delayed by one month because of new rules such as online tagging, and as a result even now half of the paddy is still with farmers or lying in markets and yards. He says rain has soaked paddy across the state, farmers do not know what to do, and the government should immediately hold a video conference and ensure the wet grain is lifted and sent to rice mills. He says mills are refusing to unload if 43 kg is not packed, officials are washing their hands of responsibility, and current deductions are 3 to 5 kg per quintal. He says even good-quality paddy is being graded as B grade, causing farmers losses, transport charges are being passed on to farmers, and there is also a shortage of gunny bags for sunflower and paddy.

procurementcrop-damagemarket-pricefertilizer-availabilitypayment-delaypaddymaizegroundnutchillibengal-gramsunflower
Open original source ↗
AI interpretation & provenance
Extracted claim

“Harish Rao inspected rain-soaked grain at Chinnakodur Market Yard in Siddipet, and the transcript says farmers are facing delays, grading issues, and deductions in paddy procurement.” · confidence 91%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4249ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:35
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  7. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  8. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  9. NARRATIVE_ASSIGNED · 16 Sept, 09:44
  10. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  11. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  12. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  13. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  14. NARRATIVE_ASSIGNED · 17 Sept, 21:03
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  18. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  19. NARRATIVE_ASSIGNED · 20 Sept, 15:40
  20. NARRATIVE_ASSIGNED · 20 Sept, 19:46
  21. NARRATIVE_ASSIGNED · 20 Sept, 23:14
  22. NARRATIVE_ASSIGNED · 21 Sept, 01:30
  23. NARRATIVE_ASSIGNED · 21 Sept, 11:17
  24. NARRATIVE_ASSIGNED · 21 Sept, 22:42
  25. NARRATIVE_ASSIGNED · 22 Sept, 05:33

mention 2eaab3fa · raw item 0c111f63 · origin live

YouTubeRTV NalgondaMedia organisation96%27 May, 15:16 IST
Nalgonda (93% conf.)Telugu / Englishstance: neutral802 views · 3 likes · 0 comments

Sravan Kumar F2F | వానాకాలానికి ఎరువులు సిద్ధం | Moonsoon Cultivation | RTV Nalgonda

Original — Telugu / English

Sravan Kumar F2F | వానాకాలానికి ఎరువులు సిద్ధం | Moonsoon Cultivation | RTV Nalgonda

Show full source text as published

Sravan Kumar F2F | వానాకాలానికి ఎరువులు సిద్ధం | Moonsoon Cultivation | RTV Nalgonda Sravan Kumar F2F | వానాకాలానికి ఎరువులు సిద్ధం | Moonsoon Cultivation | RTV Nalgonda #sravankumar #moonsooncultivation #rtvnalgonda ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Sravan Kumar F2F | Fertilizers are ready for the monsoon season | Monsoon Cultivation | RTV Nalgonda

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions that fertilizers are prepared for the monsoon season.” · confidence 74%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 85%Classification confidence: 86%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3561ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:40
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 2c5912e0 · raw item 323b213c · origin live

YouTubeHitech Tv News IndiaMedia organisation98%22 May, 23:15 IST
Adilabad (98% conf.)Englishstance: neutral40 views · 2 likes · 0 comments

Adilabad: Jayant Police Busted Major Racket Of Fake Fertilizers & Seized 60 Sacks.

Original — English

Adilabad: Jayant Police Busted Major Racket Of Fake Fertilizers & Seized 60 Sacks.

Show full source text as published

Adilabad: Jayant Police Busted Major Racket Of Fake Fertilizers & Seized 60 Sacks. Welcome to Hitech Tv News India, your premier source for the latest news and updates from Hyderabad, Telangana, Andhra Pradesh, Delhi, Uttar Pradesh, India. Our channel is dedicated to empowering the generation with insightful reporting and engaging content. Tune in to Channel No. 41 on GTPL Cable Network and Channel No. 195 on U Digital Cable Network to stay informed. For News or Advertisement, reach us at +919533776858 or hitechnewspvtltd@gmail.com or visit our website at www.hitechtvnews.com. Join us on this journey and subscribe for a front-row seat to the news that matters.

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Jayant Police in Adilabad busted a fake fertilizer racket and seized 60 sacks.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2908ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:26
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 2d03b0ca · raw item 666cb548 · origin live

YouTubeANN TeluguMedia organisation87%22 May, 19:35 IST
Adilabad · జైనథ్ (99% conf.)Telugu / Englishstance: neutral25 views · 1 likes · 0 comments

ADILABAD : జైనథ్ మండలంలో నకిలీ ఎరువుల ముఠా గుట్టు రట్టు | Fake Fertilizer Rocket | ANN Telugu

Original — Telugu / English

For more latest updates on the news : ► FacebookGroup :

Show full source text as published

ADILABAD : జైనథ్ మండలంలో నకిలీ ఎరువుల ముఠా గుట్టు రట్టు | Fake Fertilizer Rocket | ANN Telugu #adilabadnews #fertilizer #telangananews #anntelugu ADILABAD : జైనథ్ మండలంలో నకిలీ ఎరువుల ముఠా గుట్టు రట్టు | Fake Fertilizer Rocket | ANN Telugu You are Watching ANN Telugu Live. It is a leading Telugu News Channel, bringing you the first account of all the latest news online from around the world including breaking news, regional news, national news, international news, sports updates, entertainment gossips, political news, crime reports. If you like this video, please don’t forget to subscribe and like, comment the ANN Telugu Live for more interesting updates and Trending Public videos. #ANNTELUGU #ANNTELUGUNEWS #ANNTeluguLive #ANN #AMMANEWS #BreakingNews #FlashNews #SpeedNews For more latest updates on the news : ► Subscribe to Amma News Channel: https://www.youtube.com/c/Ammanewslivev ► Like us on Facebook: https: https://www.facebook.com/Ammanewslive/ ► Follow us on Twitter : https://twitter.com/ammanews1 ► ShareChat : https://sharechat.com/profile/ammanewslive?referrer=copyLink ► FacebookGroup : https://www.facebook.com/groups/1813851678807723 ► Instagram : https://instagram.com/ammanewslive11?utm_medium=copy_link ► Koo APP https://www.kooapp.com/profile/AmmaNewsLive #Telangananews #Hyderabadnews #Adilabadnews #ammanews #ANNTELUGU #ANNTeluguLive #ANNTELUGUHD #ANNTeluguNewsChannel #TelanganaNews #APNews #AndhraPradeshNews #TeluguLiveUpdates #TeluguNewsLive #TeluguLive #LiveTV #TeluguNews #Telugunewslive #TeluguLive #TeluguNews #latesttelugunews #TeluguNewsChannel #LatestNews #telugu #TeluguBreakingNews #TSnews #TelanganaNews #TelanganaNews #AndhrapradeshNews #HyderabadNews #politicalnews #telanganapolitics

English · AI translation

ADILABAD: A fake fertilizer gang was exposed in Jainath mandal | Fake Fertilizer Rocket | ANN Telugu For more latest updates on the news : ► FacebookGroup :

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A fake fertilizer gang was exposed in Jainath mandal, Adilabad.” · confidence 97%

Sentiment: negativeStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1708ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:26
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 640bcf8d · raw item 5c1d58f8 · origin live

YouTubeAkashvani Adilabad 100.2 FMMedia organisation97%22 May, 14:30 IST
Adilabad · bazarhathnoor (98% conf.)Telugustance: neutral60 views · 3 likes · 0 comments

భూసార పరీక్షల ఆధారిత ఎరువుల యాజమాన్యం || సమీకృత వ్యవసాయం

Original — Telugu

కిసాన్ వాణి (Kisanvani) కేంద్ర వ్యవసాయ మరియు రైతు సంక్షేమ మంత్రిత్వ శాఖ వారి ప్రాయోజిత కార్యక్రమం. "భూసార పరీక్షల ఆధారిత ఎరువుల యాజమాన్యం" ఆదిలాబాద్ కృషి విజ్ఞాన కేంద్రం శాస్త్రవేత్త ఎం.సురేష్ తో ముచ్చట. ముచ్చట పెట్టింది : కె.లెనిన్. 14 మే 2026, గురువారం @ రాత్రి 07.15 ని.లకు ! "రైతు అంతరంగం" "సమీకృత వ్యవసాయం" గురించి బజార్ హత్నూర్ మండలం కొత్తగూడ గ్రామానికి చెందిన రైతు కాళె గణపతితో ముచ్చట. ముచ్చట పెట్టింది : యు.దినేష్. 14 మే 2026, గురువారం @ రాత్రి 07.15 ని.లకు ! ''రైతు అంతరంగం " కార్యక్రమంలో తెలంగాణ యాస, బాసలకు అచ్చమైన నెలవు ఆకాశవాణి ఆదిలాబాద్ 100.2 FM మనసు నిండ…..! *ఈ కార్యక్రమాన్ని News on AIR app ద్వారా ప్రపంచంలో ఎక్కడైనా వినవచ్చు* bit.ly/AIRADB #AkashvaniAdilabad #AIRAdilabad #100.2FM #moafw See less తెలంగాణ యాస, బాసలకు అచ్చమైన నెలవు ఆకాశవాణి ఆదిలాబాద్ 100.2 FM మనసు నిండ…..! *ఈ కార్యక్రమాన్ని News on AIR app ద్వారా ప్రపంచంలో ఎక్కడైనా వినవచ్చు* bit.ly/AIRADB

Show full source text as published

భూసార పరీక్షల ఆధారిత ఎరువుల యాజమాన్యం || సమీకృత వ్యవసాయం #AgriGoI #moafw #agrigoi #moafw #kisanvani #Akashvani #akashvaniadilabad #Telangana #lrs #adilabadadda కిసాన్ వాణి (Kisanvani) కేంద్ర వ్యవసాయ మరియు రైతు సంక్షేమ మంత్రిత్వ శాఖ వారి ప్రాయోజిత కార్యక్రమం. ************************************************************* "భూసార పరీక్షల ఆధారిత ఎరువుల యాజమాన్యం" ఆదిలాబాద్ కృషి విజ్ఞాన కేంద్రం శాస్త్రవేత్త ఎం.సురేష్ తో ముచ్చట. ముచ్చట పెట్టింది : కె.లెనిన్. 14 మే 2026, గురువారం @ రాత్రి 07.15 ని.లకు ! =================================== "రైతు అంతరంగం" ********************** "సమీకృత వ్యవసాయం" గురించి బజార్ హత్నూర్ మండలం కొత్తగూడ గ్రామానికి చెందిన రైతు కాళె గణపతితో ముచ్చట. ముచ్చట పెట్టింది : యు.దినేష్. 14 మే 2026, గురువారం @ రాత్రి 07.15 ని.లకు ! ''రైతు అంతరంగం " కార్యక్రమంలో =================================== తెలంగాణ యాస, బాసలకు అచ్చమైన నెలవు ఆకాశవాణి ఆదిలాబాద్ 100.2 FM మనసు నిండ…..! ______________________________________________________________________ *ఈ కార్యక్రమాన్ని News on AIR app ద్వారా ప్రపంచంలో ఎక్కడైనా వినవచ్చు* bit.ly/AIRADB #AkashvaniAdilabad #AIRAdilabad #100.2FM #moafw See less తెలంగాణ యాస, బాసలకు అచ్చమైన నెలవు ఆకాశవాణి ఆదిలాబాద్ 100.2 FM మనసు నిండ…..! ______________________________________________________________________ *ఈ కార్యక్రమాన్ని News on AIR app ద్వారా ప్రపంచంలో ఎక్కడైనా వినవచ్చు* bit.ly/AIRADB #AkashvaniAdilabad #AIRAdilabad #100.2FM #moafw

English · AI translation

Soil test-based fertilizer management || Integrated farming Kisanvani is a sponsored program by the Ministry of Agriculture and Farmers Welfare, Government of India. A conversation on "Soil test-based fertilizer management" with scientist M. Suresh from Adilabad Krishi Vigyan Kendra. Hosted by: K. Lenin. Thursday, 14 May 2026 @ 7.15 PM! In the "Raitu Intarangam" program, A conversation on "Integrated farming" with farmer Kale Ganapati from Kothaguda village, Bazarhathnoor mandal. Hosted by: U. Dinesh. Thursday, 14 May 2026 @ 7.15 PM! In the "Raitu Intarangam" program. The true home for Telangana dialects and slang Akashvani Adilabad 100.2 FM full of heart.....! *You can listen to this program anywhere in the world through the News on AIR app* bit.ly/AIRADB

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The program includes a discussion on fertilizer management based on soil testing with scientist M. Suresh from Adilabad KVK.” · confidence 91%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3832ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:23
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 19fc9a5c · raw item 6d759a42 · origin live

YouTubeCVR News TeluguMedia organisation96%17 May, 17:43 IST
Nizamabad (98% conf.)Telugu / Englishstance: neutral9,897 views · 51 likes · 0 comments
Was live

నిజామాబాద్ జిల్లా లో ఎరువుల కొరత | Fertilizer Shortage In Nizamabad District | CVR News

Original — Telugu / English

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

నిజామాబాద్ జిల్లా లో ఎరువుల కొరత | Fertilizer Shortage In Nizamabad District | CVR News #nizambadfarmers #fertilizershortage #districtagricultureofficer #cvrnews నిజామాబాద్ జిల్లా లో ఎరువుల కొరత | Fertilizer Shortage In Nizamabad District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Nizamabad district is facing a fertilizer shortage | Fertilizer Shortage In Nizamabad District | CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer shortage in Nizamabad district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2466ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:57
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:00
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention fb6b4f82 · raw item 21150550 · origin live

YouTubeMega9TV AgriMedia organisation89%15 May, 08:00 IST
Adilabad (92% conf.)Telugu / Englishstance: neutral1,457 views · 17 likes · 2 comments

ఎకరంలో 30 నిమిషాల్లో విత్తనం | Drone Plants Sesame Seeds & Spread Fertilizers In Minutes | Adilabad

Original — Telugu / English

ఎకరంలో 30 నిమిషాల్లో విత్తనం | Drone Plants Sesame Seeds & Spread Fertilizers In Minutes | Adilabad | mega9tv

Show full source text as published

ఎకరంలో 30 నిమిషాల్లో విత్తనం | Drone Plants Sesame Seeds & Spread Fertilizers In Minutes | Adilabad ఎకరంలో 30 నిమిషాల్లో విత్తనం | Drone Plants Sesame Seeds & Spread Fertilizers In Minutes | Adilabad | mega9tv #mega9agri Mega9Agri channel is from mega9tv Telugu channel, Follow mega9Agri channel for news related to agriculture, farming, cultivation, new farming techniques, new farming equipment updates, use of organic pesticides, making of pesticides, organic farming, poultry farming, dairy products and many more #naturalfarming #farming #farm #farmer #nature #agro #agriculture #agri #organic #harvest #horticulture #food #agribusiness #garden #sustainableagriculture #urbanagriculture #harvest #producess #landscape #milk #cows #yeild #fish #aqua #dairy #fruits #plants # pestisides #sprayer #pestigation #fertilizers #weed #field #technology #drip #mechaniry #sprinkelers # marketyard #crops #fruiting #flowering #harvest #ripeing #ponds #lakes #grass #birds #animals #livestocks #fodder #dease #transport #planter # shadenet # polyhouse # highdensity # hybrid #varities #dryfield #wetland #poultry #millets #process # weather #season #hybrid # research #insects #tools # market #vegitables #crepers #schemes #export

English · AI translation

Sowing in an acre in 30 minutes | Drone Plants Sesame Seeds & Spread Fertilizers In Minutes | Adilabad Sowing in an acre in 30 minutes | Drone Plants Sesame Seeds & Spread Fertilizers In Minutes | Adilabad | mega9tv

farm-mechanisationseedsfertilizer-availabilityseed-availabilitygroundnut
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content says a drone can plant sesame seeds and spread fertilizers in 30 minutes in an acre in Adilabad.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1688ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:24
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  7. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  20. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f11ba5a3 · raw item 9157f5ca · origin live

YouTubeDD NEWS TelanganaMedia organisation99%13 May, 20:27 IST
Peddapalli (97% conf.)Englishstance: neutral29 views · 0 likes · 0 comments

Professor Ella Goud Advises Farmers to Reduce Chemical Fertilizers in Peddapalli District

Original — English

Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms:

Show full source text as published

Professor Ella Goud Advises Farmers to Reduce Chemical Fertilizers in Peddapalli District Official YouTube channel of DD News Telangana. Stay Connected with Us: Keep up with the latest updates on all our digital platforms: YouTube: https://www.youtube.com/@ddnewstelangana Instagram: https://www.instagram.com/ddnewstelangana Twitter (X): https://x.com/ddyadagirinews Facebook: https://www.facebook.com/DDNewsHyderabad #DDNewsTelangana #TelanganaUpdates #HyderabadNews #LatestNews #PublicServiceBroadcasting #TeluguNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Professor Ella Goud advises farmers in Peddapalli District to reduce chemical fertilizers.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 80%Agriculture relevance: 80%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1766ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:35
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f4e2dd43 · raw item f15b3745 · origin live

YouTubeIFFCO TelanganaMedia organisation86%13 May, 11:37 IST
Narayanpet · Kosgi (98% conf.)Telugustance: supportive5 views · 0 likes · 0 comments

నారాయణపేట జిల్లాలో వరి రైతు Nano ఎరువుల అనుభవం

Original — Telugu

నారాయణపేట జిల్లాలో Nano ఎరువులపై రైతుల విశ్వాసం

English · AI translation

My name is Anil Kumar. I am from our village, Eezeepur, in Kosgi mandal, Narayanpet district. I have been using Nano Urea and Nano DAP on my paddy crop since last year. I mixed this product with every pesticide and sprayed it. One bottle is equal to one bag. By using this Nano Urea and Nano DAP, the weeds in our crops have reduced a lot so far. If you want higher yields and higher profits, you can use Nano Urea and Nano DAP.

fertilizer-availabilitypaddy
Open original source ↗
AI interpretation & provenance
Extracted claim

“A paddy farmer from Eezeepur village in Kosgi mandal, Narayanpet district says he has been using Nano Urea and Nano DAP on his crop since last year and that it reduced weeds and helped increase yield and profits.” · confidence 95%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2203ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:44
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention bddfc3bd · raw item 673e6634 · origin live

YouTubeCVR News TeluguMedia organisation96%7 May, 17:00 IST
Peddapalli (97% conf.)Englishstance: neutral162 views · 0 likes · 0 comments
Was live

Contract Wokers Protest On Local Jobs In Front Of Ramagundam Fertilizer Factory In Peddapalli

Original — English

Contract Wokers Protest On Local Jobs In Front Of Ramagundam Fertilizer Factory In Peddapalli District || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

Contract Wokers Protest On Local Jobs In Front Of Ramagundam Fertilizer Factory In Peddapalli #workersprotest #ramagundam #peddapallidistrict #cvrnews Contract Wokers Protest On Local Jobs In Front Of Ramagundam Fertilizer Factory In Peddapalli District || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Contract workers protested in front of the Ramagundam Fertilizer Factory in Peddapalli District over local jobs.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 55%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1672ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:36
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 2fd79ff7 · raw item a087c88c · origin live

YouTubeTV5 News Media organisation98%28 Apr, 10:07 IST
Nalgonda (99% conf.)Telugu / Englishstance: neutral374 views · 3 likes · 0 comments

నల్గొండ జిల్లాలో ఎరువుల డీలర్ల బంద్..Dealers Protest Over Reduction In Fertilizer Supply, Nalgonda

Original — Telugu / English

నల్గొండ జిల్లాలో ఎరువుల డీలర్ల బంద్..Dealers Protest Over Reduction In Fertilizer Supply, Nalgonda

Show full source text as published

నల్గొండ జిల్లాలో ఎరువుల డీలర్ల బంద్..Dealers Protest Over Reduction In Fertilizer Supply, Nalgonda Watch TV5 News LIVE : https://www.youtube.com/live/ho9JlBnrGWg The channel telecasts hourly Telugu news bulletins and 30 special news bulletins, with the support of 294 special reporters in every constituency of the Telugu states of Andhra Pradesh and Telangana, in addition to bureaus in Hyderabad, Vishakapatnam, and Vijayawada. Its news bulletins last round 20–25 minutes (without including commercials). One of the channel's notable features is its business content. Market analysts provide financial analysis to the audience on a day-to-day basis. The channel has won the best business show award from a national television awards committee Subscribe to TV5 News for Latest Happenings and Breaking news from Andhra and Telangana. For More Updates ► TV5 News Live : https://youtu.be/ox2rT1KRkFI ► Subscribe to TV5 News Channel: http://goo.gl/NHJD9 ►Our Website : http://www.tv5news.in ► Like us on Facebook: http://www.facebook.com/tv5newschannel ► Follow us on Twitter: https://twitter.com/tv5newsnow ► Follow us on Pinterest: https://www.pinterest.com/tv5newschannel

English · AI translation

Fertilizer dealers’ shutdown in Nalgonda district.. Dealers Protest Over Reduction In Fertilizer Supply, Nalgonda

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer dealers in Nalgonda district are protesting over a reduction in fertilizer supply.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2151ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:58
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention d6f95805 · raw item b68ddf36 · origin live

YouTubehmtv Telugu NewsMedia organisation99%28 Apr, 07:33 IST
Hanumakonda (92% conf.)Telugu / Englishstance: neutral117 views · 0 likes · 0 comments

ఎరువుల దుకాణాల‌ బంద్ విజ‌య‌వంతం | Fertilizer Shops' Strike Successful | Hanamkonda | hmtv

Original — Telugu / English

HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

Show full source text as published

ఎరువుల దుకాణాల‌ బంద్ విజ‌య‌వంతం | Fertilizer Shops' Strike Successful | Hanamkonda | hmtv ఎరువుల దుకాణాల‌ బంద్ విజ‌య‌వంతం | Fertilizer Shops' Strike Successful | Hanamkonda | hmtv #hanumakonda #fertilizershops #strike #hmtv HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: ► FB: https://www.facebook.com/hmtvnewslive ► Twitter: https://twitter.com/hmtvnewslive ► Instagram: https://www.instagram.com/hmtvnewsofficial/?hl=en ►Telegram: https://t.me/hmtvnewslive ► Watch hmtv Live: https://youtube.com/live/3JodH4xoqJs ► Subscribe to hmdgtl: https://www.youtube.com/@hmdgtl?sub_confirmation=1 ► For News in Telugu: http://www.hmtvlive.com/ ► For News in English: http://www.thehansindia.com ► Follow us on our Whatsapp Channel: https://whatsapp.com/channel/0029Va9MPsgCMY0AFP9BeE3n Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. 🔹 24/7 News 🔹 Politics & Current Affairs 🔹 Entertainment & Cinema 🔹 Sports Highlights 🔹 Cultural Stories & Folk Music 🔹 Documentaries & Features 🔹 Interviews & Insights 🔹 Thought-Provoking Debates & Conclaves hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332 Stay informed and engaged—subscribe to hmtv and never miss a beat! 🔔 Subscribe Now: http://goo.gl/f9lm5E #TeluguNews #TelanganaNews #APNews #RevanthReddy #ChandrababuNaidu #PawanKalyan #PoliticalNews #IPL2026 #Tollywood #breakingnews

English · AI translation

Fertilizer shops' strike successful | Hanamkonda | hmtv HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The fertilizer shop bandh in Hanamkonda was successful.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 95%Classification confidence: 86%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2370ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:34
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:36
  3. ENRICHED · 9 Sept, 22:38
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 1079c135 · raw item 599deb37 · origin live

YouTubeinews teluguMedia organisation97%27 Apr, 20:41 IST
Adilabad (95% conf.)Telugu / Englishstance: neutral199 views · 2 likes · 0 comments
Was live

ఉమ్మడి ఆదిలాబాద్ లో ఎరువుల దుకాణాలు బంద్ | Fertilizer Shops Strike | Adilabad | iNews

Original — Telugu / English

ఉమ్మడి ఆదిలాబాద్ లో ఎరువుల దుకాణాలు బంద్ | Fertilizer Shops Strike | Adilabad | iNews

Show full source text as published

ఉమ్మడి ఆదిలాబాద్ లో ఎరువుల దుకాణాలు బంద్ | Fertilizer Shops Strike | Adilabad | iNews ఉమ్మడి ఆదిలాబాద్ లో ఎరువుల దుకాణాలు బంద్ | Fertilizer Shops Strike | Adilabad | iNews #adilabadnews #fertilizershops #breakingnews #latestnews #inews About Channel: iNews Telugu is a leading 24x7 satellite and digital news channel from Udbhav Media Pvt. Ltd., bringing breaking news, political analysis, entertainment, and social stories from across Andhra Pradesh and Telangana.We’re committed to truthful, unbiased, and powerful journalism that informs and empowers Telugu viewers. Our trusted programs like In Depth, I Focus, I Special, Idhi Nijam, and Loguttu are among the most-watched Telugu news shows, known for credibility and impact. Stay connected with real-time updates, exclusive interviews, live debates, and ground reports that go beyond the headlines. Subscribe to iNews Telugu – Your Source for Trusted Telugu News. Stay Alert. Stay Aware. Stay Ahead. Disclaimer: iNews may provide content through third-party websites, operating systems, platforms, and portals (‘Third-Party Platforms’). iNews does not control and has no liability for Third-Party Platforms, including content hosted, advertisements, security, functionality, operation, or availability. Please keep discussions on this channel clean and respectful and refrain from using racist or sexist slurs and personal insults. Follow Us On 👍Facebook : https://www.facebook.com/INews 📷INSTAGRAM : https://www.instagram.com/inewsofficial 🐦Twitter (X) : https://x.com/inewstelugu 📱Whatsapp : https://shorturl.at/BcUNu Also Watch i Special : https://shorturl.at/HXOe0 I Focus : https://shorturl.at/S6fmT Loguttu : https://shorturl.at/AHZIO Idhi Nijam : https://shorturl.at/s2qcM Subscribe More iNews AP : https://www.youtube.com/@iNewsAP iNews ENT : https://www.youtube.com/@inewsentertainment iNews TS : https://www.youtube.com/@inewsTS

English · AI translation

Fertilizer shops are closed in combined Adilabad | Fertilizer Shops Strike | Adilabad | iNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer shops in Adilabad are closed on strike.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 98%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1788ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:24
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention ef2a9425 · raw item b298dadf · origin live

YouTubeRTV WarangalMedia organisation92%27 Apr, 19:07 IST
Warangal (86% conf.)Telugustance: critical486 views · 6 likes · 1 comments

ఎరువుల సరఫరాపై FPL విధానాన్ని అమలు చేయాలి | Fertilizer Shop Dealers Protest | RTV Warangal

Original — Telugu

ఎరువుల సరఫరాపై FPL విధానాన్ని అమలు చేయాలి | Fertilizer Shop Dealers Protest | RTV Warangal

Show full source text as published

ఎరువుల సరఫరాపై FPL విధానాన్ని అమలు చేయాలి | Fertilizer Shop Dealers Protest | RTV Warangal ఎరువుల సరఫరాపై FPL విధానాన్ని అమలు చేయాలి | Fertilizer Shop Dealers Protest | RTV Warangal #fertilizershops #protest #dealers #rtvwarangal ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Implement the FPL policy for fertilizer supply | Fertilizer Shop Dealers Protest | RTV Warangal

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer shop dealers are protesting to demand implementation of the FPL policy for fertilizer supply.” · confidence 95%

Sentiment: negativeStance toward government: criticalTelangana relevance: 98%Agriculture relevance: 96%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2047ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:34
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:35
  3. ENRICHED · 9 Sept, 22:38
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 76c3bafd · raw item 9801eaeb · origin live

YouTubehmtv Telugu NewsMedia organisation99%27 Apr, 17:38 IST
Adilabad (98% conf.)Telugustance: neutral788 views · 7 likes · 0 comments
Was live

ఉమ్మడి ఆదిలాబాద్ జిల్లా వ్యాప్తంగా ఎరువుల దుకాణాల బంద్ | Fertilizer Shops Strike | Adilabad | hmtv

Original — Telugu

HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

Show full source text as published

ఉమ్మడి ఆదిలాబాద్ జిల్లా వ్యాప్తంగా ఎరువుల దుకాణాల బంద్ | Fertilizer Shops Strike | Adilabad | hmtv ఉమ్మడి ఆదిలాబాద్ జిల్లా వ్యాప్తంగా ఎరువుల దుకాణాల బంద్ | Fertilizer Shops Strike | Adilabad | hmtv #adilabad #Fertilizershops #breakingnews #hmtv HMTV Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. Follow hmtv on: ► FB: https://www.facebook.com/hmtvnewslive ► Twitter: https://twitter.com/hmtvnewslive ► Instagram: https://www.instagram.com/hmtvnewsofficial/?hl=en ►Telegram: https://t.me/hmtvnewslive ► Watch hmtv Live: https://youtube.com/live/3JodH4xoqJs ► Subscribe to hmdgtl: https://www.youtube.com/@hmdgtl?sub_confirmation=1 ► For News in Telugu: http://www.hmtvlive.com/ ► For News in English: http://www.thehansindia.com ► Follow us on our Whatsapp Channel: https://whatsapp.com/channel/0029Va9MPsgCMY0AFP9BeE3n Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. 🔹 24/7 News 🔹 Politics & Current Affairs 🔹 Entertainment & Cinema 🔹 Sports Highlights 🔹 Cultural Stories & Folk Music 🔹 Documentaries & Features 🔹 Interviews & Insights 🔹 Thought-Provoking Debates & Conclaves hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332 Stay informed and engaged—subscribe to hmtv and never miss a beat! 🔔 Subscribe Now: http://goo.gl/f9lm5E #TeluguNews #TelanganaNews #APNews #RevanthReddy #ChandrababuNaidu #PawanKalyan #PoliticalNews #IPL2026 #Tollywood #breakingnews

English · AI translation

Fertilizer shops strike across the erstwhile Adilabad district | Fertilizer Shops Strike | Adilabad | hmtv

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer shops across the erstwhile Adilabad district are shut.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1451ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:27
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 18866f18 · raw item 42f89c31 · origin live

YouTubeRTV WarangalMedia organisation92%27 Apr, 17:19 IST
Warangal (93% conf.)Telugu / Englishstance: neutral512 views · 10 likes · 1 comments

రాష్ట్ర వ్యాప్తంగా ఎరువుల షాపులు బంద్ ఎందుకంటే...! | Fertilizer Dealer Nagurla Venkateshwarlu F2F

Original — Telugu / English

రాష్ట్ర వ్యాప్తంగా ఎరువుల షాపులు బంద్ ఎందుకంటే...! | Fertilizer Dealer Nagurla Venkateshwarlu F2F | RTV Warangal

Show full source text as published

రాష్ట్ర వ్యాప్తంగా ఎరువుల షాపులు బంద్ ఎందుకంటే...! | Fertilizer Dealer Nagurla Venkateshwarlu F2F రాష్ట్ర వ్యాప్తంగా ఎరువుల షాపులు బంద్ ఎందుకంటే...! | Fertilizer Dealer Nagurla Venkateshwarlu F2F | RTV Warangal #fertilizershops #protest #rtvwarangal ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Why are fertilizer shops shut across the state...! | Fertilizer Dealer Nagurla Venkateshwarlu F2F Why are fertilizer shops shut across the state...! | Fertilizer Dealer Nagurla Venkateshwarlu F2F | RTV Warangal

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer shops are closed across the state.” · confidence 88%

Sentiment: neutralStance toward government: neutralTelangana relevance: 96%Agriculture relevance: 90%Classification confidence: 86%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1877ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:26
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention d72affd8 · raw item a23bb9dd · origin live

YouTubeinews teluguMedia organisation97%27 Apr, 14:35 IST
Nizamabad (98% conf.)Telugustance: neutral132 views · 0 likes · 0 comments
Was live

నిజామాబాద్ లో ఎరువుల దుకాణాలు బంద్! | Fertilizer Shops Strike Updates | Nizamabad | iNews

Original — Telugu

నిజామాబాద్ లో ఎరువుల దుకాణాలు బంద్! | Fertilizer Shops Strike Updates | Nizamabad | iNews

Show full source text as published

నిజామాబాద్ లో ఎరువుల దుకాణాలు బంద్! | Fertilizer Shops Strike Updates | Nizamabad | iNews నిజామాబాద్ లో ఎరువుల దుకాణాలు బంద్! | Fertilizer Shops Strike Updates | Nizamabad | iNews #nizamabad #fertilizershortage #breakingnews #latestnews #inews About Channel: iNews Telugu is a leading 24x7 satellite and digital news channel from Udbhav Media Pvt. Ltd., bringing breaking news, political analysis, entertainment, and social stories from across Andhra Pradesh and Telangana.We’re committed to truthful, unbiased, and powerful journalism that informs and empowers Telugu viewers. Our trusted programs like In Depth, I Focus, I Special, Idhi Nijam, and Loguttu are among the most-watched Telugu news shows, known for credibility and impact. Stay connected with real-time updates, exclusive interviews, live debates, and ground reports that go beyond the headlines. Subscribe to iNews Telugu – Your Source for Trusted Telugu News. Stay Alert. Stay Aware. Stay Ahead. Disclaimer: iNews may provide content through third-party websites, operating systems, platforms, and portals (‘Third-Party Platforms’). iNews does not control and has no liability for Third-Party Platforms, including content hosted, advertisements, security, functionality, operation, or availability. Please keep discussions on this channel clean and respectful and refrain from using racist or sexist slurs and personal insults. Follow Us On 👍Facebook : https://www.facebook.com/INews 📷INSTAGRAM : https://www.instagram.com/inewsofficial 🐦Twitter (X) : https://x.com/inewstelugu 📱Whatsapp : https://shorturl.at/BcUNu Also Watch i Special : https://shorturl.at/HXOe0 I Focus : https://shorturl.at/S6fmT Loguttu : https://shorturl.at/AHZIO Idhi Nijam : https://shorturl.at/s2qcM Subscribe More iNews AP : https://www.youtube.com/@iNewsAP iNews ENT : https://www.youtube.com/@inewsentertainment iNews TS : https://www.youtube.com/@inewsTS

English · AI translation

Fertilizer shops are shut in Nizamabad! | Fertilizer Shops Strike Updates | Nizamabad | iNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer shops are shut in Nizamabad.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1977ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:57
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:58
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 96cbba18 · raw item 00180bfd · origin live

YouTubeTV9 Telugu LiveMedia organisation99%20 Apr, 22:31 IST
Jagtial (98% conf.)Telugustance: critical4,307 views · 77 likes · 0 comments

KCR : ప్రభుత్వానికి ఎరువు బస్తా కూడా ఇవ్వడం చేత కావడం లేదు | BRS Public Meeting in Jagtial - TV9

Original — Telugu

Follow TV9 Telugu on Social Media:

Show full source text as published

KCR : ప్రభుత్వానికి ఎరువు బస్తా కూడా ఇవ్వడం చేత కావడం లేదు | BRS Public Meeting in Jagtial - TV9 KCR : ప్రభుత్వానికి ఎరువు బస్తా కూడా ఇవ్వడం చేత కావడం లేదు | BRS Public Meeting in Jagtial - TV9 🔔 Subscribe to TV9 Telugu & press the Bell Icon for breaking news alerts. 👍 Like | Comment | Share Follow TV9 Telugu on Social Media: ► TV9 News App : https://onelink.to/de8b7y ► తాజా వార్తల కోసం : https://tv9telugu.com/ ► Follow us on X : https://twitter.com/Tv9Telugu ► Like us on Facebook: https://www.facebook.com/tv9telugu ► Follow us on Instagram: https://www.instagram.com/tv9telugu ► Follow us on Threads: https://www.threads.net/@tv9telugu ► Follow us on WhatsApp: https://whatsapp.com/channel/0029VaARkBWBFLgLrGrDcX3N #BRS #KCR #Telangana #JeevanReddy #BRSPublicMeeting #Jagtial #TelanganaPolitics #GulabiJenda #PoliticalRally #TelanganaNews #TV9Telugu #BreakingNews #tv9telugu #prasad

English · AI translation

KCR: The government is not even able to provide a fertilizer bag | BRS Public Meeting in Jagtial - TV9 Follow TV9 Telugu on Social Media:

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The government is not able to provide even a fertilizer bag.” · confidence 94%

Sentiment: negativeStance toward government: criticalTelangana relevance: 90%Agriculture relevance: 70%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2445ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:40
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention a36947f8 · raw item 0fa03400 · origin live

YouTubeiffcobalajeeDealer78%15 Apr, 20:00 IST
Nizamabad · Morthad (99% conf.)Telugu / Englishstance: neutral194 views · 1 likes · 0 comments

ఇఫ్కో నానో యూరియా నానో DAP వాడిన మోర్తాడ్ రైతు అనుభవం #agriculture #iffco #farming

Original — Telugu / English

ఇఫ్కో నానో యూరియా నానో DAP వాడిన మోర్తాడ్ రైతు అనుభవం Today i have collected a *Testimonial video of Nano Urea plus & Nano DAP* Farmer name:- A. Srinivas Crop : Paddy Village:- Wadyat Mandal: Morthad Dist: Nizamabad Thanks &Regards K.Nithin kumar Morthad

English · AI translation

Testimonial of a farmer from Morthad who used IFFCO Nano Urea and Nano DAP #agriculture #iffco #farming Testimonial of a farmer from Morthad who used IFFCO Nano Urea and Nano DAP Today I have collected a testimonial video of Nano Urea Plus & Nano DAP Farmer name: A. Srinivas Crop: Paddy Village: Wadyat Mandal: Morthad Dist: Nizamabad Thanks & Regards K. Nithin Kumar Morthad

fertilizer-availabilitypaddy
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A testimonial video was collected about using Nano Urea Plus and Nano DAP by a farmer named A. Srinivas from Wadyat village, Morthad mandal, Nizamabad district.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2561ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:57
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:59
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 65128744 · raw item 2ee94a0e · origin live

YouTubeiffcobalajeeDealer78%13 Apr, 19:51 IST
Nizamabad (99% conf.)Telugustance: neutral60 views · 0 likes · 0 comments

వివిధ పంట లలో ఇఫ్కో నానో ఎరువుల వాడిన నిజామాబాద్ జిల్లా రైతు అనుభవం

Original — Telugu

వివిధ పంట లలో ఇఫ్కో నానో ఎరువుల వాడిన నిజామాబాద్ జిల్లా రైతు అనుభవం

English · AI translation

Experience of a Nizamabad district farmer using IFFCO nano fertilizers in various crops.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A farmer from Nizamabad district has experience using IFFCO nano fertilizers in various crops.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2093ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 7cdf5344 · raw item 66cbbb00 · origin live

YouTubeCVR News TeluguMedia organisation96%9 Apr, 07:48 IST
Nizamabad (98% conf.)Telugu / Englishstance: neutral205 views · 0 likes
Was live

ఎరువుల కోసం రోడ్డెక్కుతున్న రైతాంగం || Fertilizers Shortage In Nizamabad District || CVR News

Original — Telugu / English

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

ఎరువుల కోసం రోడ్డెక్కుతున్న రైతాంగం || Fertilizers Shortage In Nizamabad District || CVR News #ureashortage #fertilizershortage #nizamabaddistrict #farmersprotest #cvrnews ఎరువుల కోసం రోడ్డెక్కుతున్న రైతాంగం || Fertilizers Shortage In Nizamabad District || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Farmers taking to the roads for fertilizers || Fertilizers Shortage In Nizamabad District || CVR News "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are taking to the roads over a fertilizer shortage in Nizamabad district.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2783ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention b1df27f7 · raw item c6264b57 · origin live

YouTubeTeja traders pdplDealer93%2 Apr, 14:15 IST
Peddapalli (93% conf.)Telugustance: neutral207 views · 9 likes · 2 comments

ఎరువుల షాప్స్ నడపాలంటే.. తేజ ట్రేడర్స్. పెద్దపల్లి. సెల్ నెంబర్ 9866507435 ||FERTILISER SHOPS||

Original — Telugu

ఎరువుల షాప్స్ నడపాలంటే.. తేజ ట్రేడర్స్. పెద్దపల్లి. సెల్ నెంబర్ 9866507435

Show full source text as published

ఎరువుల షాప్స్ నడపాలంటే.. తేజ ట్రేడర్స్. పెద్దపల్లి. సెల్ నెంబర్ 9866507435 ||FERTILISER SHOPS|| ఎరువుల షాప్స్ నడపాలంటే.. తేజ ట్రేడర్స్. పెద్దపల్లి. సెల్ నెంబర్ 9866507435 #fertilizershops #problems #farming #tejatraderspeddapalli #farmersduelist #outstanding #రైతులు #వ్యవసాయం #బాకీలు #ఫర్టిలైజర్ #stocksproblems

English · AI translation

To run fertilizer shops.. Teja Traders. Peddapalli. Cell number 9866507435 ||FERTILISER SHOPS|| To run fertilizer shops.. Teja Traders. Peddapalli. Cell number 9866507435

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Teja Traders offers fertilizer shop services in Peddapalli and can be contacted at 9866507435.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2398ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 4df27274 · raw item 100b2440 · origin live

YouTubeSATYA NEWS TV TELANGANAMedia organisation98%31 Mar, 21:59 IST
Nalgonda · tipparti (98% conf.)Telugustance: neutral38 views · 2 likes · 0 comments

నానో ఎరువుల వైపు రైతులను ప్రోత్సహించా లన్న నల్లగొండ జిల్లాకలెక్టర్ బి.చంద్రశేఖర్ | SATYA | NEWS |

Original — Telugu

నానో ఎరువుల వైపు రైతులను ప్రోత్సహించా లన్న నల్లగొండ జిల్లాకలెక్టర్ బి.చంద్రశేఖర్ | SATYA | NEWS |

Show full source text as published

నానో ఎరువుల వైపు రైతులను ప్రోత్సహించా లన్న నల్లగొండ జిల్లాకలెక్టర్ బి.చంద్రశేఖర్ | SATYA | NEWS | #dailynews #31MARCH #2026 #satya #news #newstoday #breakingnews #newsheadlines

English · AI translation

Nalgonda District Collector B. Chandrasekhar instructed agriculture officials to encourage farmers toward sustainable agriculture through nano fertilizers. On Tuesday, he attended as the chief guest at a technical demonstration programme held on the use of nano fertilizers to promote sustainable agriculture for agriculture officials at the Duppalapally Rytu Vedika in Tipparti mandal. He said that farmers should be made aware of the use of nano urea and that steps should be taken to increase crop yields by efficiently using nano urea through drone technology. He said farmers should be prepared in advance for the 2026 monsoon season cultivation. He said farmers should be encouraged to grow fine variety paddy. He suggested that advance planning should be made to increase the use of agricultural machinery during the monsoon season. He said crop rotation methods should be explained to farmers and crops such as groundnut, green gram and black gram should be promoted. He also said farmers should be directed toward horticultural crops and should cultivate high-income crops such as sweet orange and Malabar crops. He said farmers should focus on cotton cultivation and that strict action should be taken so that farmers do not get cheated by buying fake cotton seeds and only original seeds should be supplied to farmers. He said cases should be registered against those selling fake seeds and that steps should be taken to ensure farmers do not face difficulties. He also said that about 10,000 soil health cards allotted to the district should be delivered to farmers quickly and that measures should be taken to improve soil health. He instructed agriculture department officials to conduct extensive awareness programmes so that farmers can move toward organic farming along with traditional methods and earn higher income. District Agriculture Officer Shravan, District Horticulture Officer D. Subhashini, Tipparti mandal AEO Sanniraj, agriculture officials and others participated in the programme.

fertilizer-availabilityseedsfarm-mechanisationfake-seedsseed-availabilitypaddycottongroundnutgreen-gramblack-gramhorticulture
Open original source ↗
AI interpretation & provenance
Extracted claim

“Nalgonda District Collector B. Chandrasekhar attended a technical demonstration event at Duppalapally Rytu Vedika in Tipparti mandal and instructed officials to promote nano fertilizers and sustainable agriculture.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 6634ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:37
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  8. NARRATIVE_ASSIGNED · 16 Sept, 09:48
  9. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  10. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  11. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  12. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  13. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  14. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  15. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention ceb7e0b6 · raw item 105811cb · origin live

YouTubeBIG TV WarangalMedia organisation98%31 Mar, 17:21 IST
Warangal (96% conf.)Telugu / Englishstance: critical277 views · 5 likes · 2 comments

Farmers Complaint Against Fertilizer Shops : ఫెర్టిలిజర్ షాప్ ల ఆగడాల పై కలెక్టర్ కు కంప్లైంట్

Original — Telugu / English

Farmers Complaint Against Fertilizer Shops : ఫెర్టిలిజర్ షాప్ ల ఆగడాల పై కలెక్టర్ కు కంప్లైంట్ | BIGTV Warangal For latest Warangal Updates Join Whatsapp Click Here ------⬇️⬇️ Big TV Telugu is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content.

Show full source text as published

Farmers Complaint Against Fertilizer Shops : ఫెర్టిలిజర్ షాప్ ల ఆగడాల పై కలెక్టర్ కు కంప్లైంట్ Farmers Complaint Against Fertilizer Shops : ఫెర్టిలిజర్ షాప్ ల ఆగడాల పై కలెక్టర్ కు కంప్లైంట్ | BIGTV Warangal #farmers #bigtvwarangal For latest Warangal Updates Join Whatsapp Click Here ------⬇️⬇️ https://chat.whatsapp.com/GHRqeqvDlDjDk4kffjiLOT https://chat.whatsapp.com/GHRqeqvDlDjDk4kffjiLOT Big TV Telugu is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content. Connect with Us: 👉 Website: https://www.bigtvlive.com/ 👉 Facebook: https://www.facebook.com/BIGTVDigitalNews 👉 Twitter: https://x.com/bigtvtelugu 👉 WhatsApp: https://whatsapp.com/channel/0029VaAe49e72WTw8YM6zr3q 👉 Instagram: https://www.instagram.com/bigtv_telugu Subscribe to Big TV Telugu for your dose of authentic, unfiltered Telugu content. Hit the bell icon to never miss an update. Let's grow together as the most informed community in Telugu politics and beyond!

English · AI translation

Farmers Complaint Against Fertilizer Shops : Complaint to the Collector over the excesses of fertilizer shops Farmers Complaint Against Fertilizer Shops : Complaint to the Collector over the excesses of fertilizer shops | BIGTV Warangal For latest Warangal Updates Join Whatsapp Click Here ------⬇️⬇️ Big TV Telugu is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers complained to the collector about fertilizer shops.” · confidence 92%

Sentiment: negativeStance toward government: criticalTelangana relevance: 98%Agriculture relevance: 90%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2288ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:26
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 4c3561ce · raw item baaa0426 · origin live

YouTubeBIGTV KarimnagarMedia organisation99%25 Mar, 12:45 IST
Peddapalli (96% conf.)Telugu / Englishstance: neutral69 views · 0 likes · 0 comments
Was live

రామగుండం లో ఎరువుల కర్మాగారం షట్డౌన్ | Fertilizer FactoryShut Down in Ramagundam | BIG TV

Original — Telugu / English

రామగుండం లో ఎరువుల కర్మాగారం షట్డౌన్ | Fertilizer FactoryShut Down in Ramagundam | BIG TV

Show full source text as published

రామగుండం లో ఎరువుల కర్మాగారం షట్డౌన్ | Fertilizer FactoryShut Down in Ramagundam | BIG TV రామగుండం లో ఎరువుల కర్మాగారం షట్డౌన్ | Fertilizer FactoryShut Down in Ramagundam | BIG TV #karimnagarlatestnews #bigtvlive #karimnagarnews #bigtvlive #bigtvkarimnagar 👉 Telangana News | Andhra Pradesh News | Karimnagar Politics | Telugu Breaking News Watch LIVE Stream : https://www.youtube.com/watch?v=ueJsgNKeq8c 🔔 Subscribe to our channel ✅ Stay Connected to Us. 👉 Website: https://www.bigtvlive.com/ 👉 Facebook: https://www.facebook.com/bigtvlive 👉 Twitter: https://twitter.com/bigtvtelugu 👉 WhatsApp: https://whatsapp.com/channel/0029VaAe49e72WTw8YM6zr3q 👉 Instagram: https://www.instagram.com/big_tv_live/ BigTV It Is A Technology First 24/7 LIVE Telugu Satellite News Channel. Watch BigTV For Exclusive News Stories, Breaking News, Political News, Exclusive Interviews, Entertainment Updates, Press Meets, Devotional Updates, Sports Updates, Live Updates, Debates And Discussions.

English · AI translation

Fertilizer factory shutdown in Ramagundam | Fertilizer Factory Shut Down in Ramagundam | BIG TV

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The fertilizer factory in Ramagundam is shut down.” · confidence 95%

Sentiment: negativeStance toward government: neutralTelangana relevance: 82%Agriculture relevance: 90%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1488ms)

Processing trail
  1. NORMALIZED · 10 Sept, 05:56
  2. RELEVANCE_ACCEPTED · 10 Sept, 05:56
  3. ENRICHED · 10 Sept, 05:57
  4. DEDUPED · 10 Sept, 05:57
  5. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 1620ee44 · raw item ad2e5087 · origin live

YouTubeKarimnagar VoiceMedia organisation72%12 Mar, 15:24 IST
Karimnagar (78% conf.)Telugustance: neutral575 views · 41 likes · 0 comments

ఎరువులు దొరకక రైతులు తిప్పలు పడుతుండ్రు#viral#former#telangaana#latestnews#breakingnews#shorts#news

Original — Telugu

ఎరువులు దొరకక రైతులు తిప్పలు పడుతుండ్రు#viral#former#telangaana#latestnews#breakingnews#shorts#news

English · AI translation

Farmers are facing difficulties because they cannot get fertilizers.#viral#former#telangaana#latestnews#breakingnews#shorts#news

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are facing difficulties because they cannot get fertilizers.” · confidence 92%

Sentiment: negativeStance toward government: neutralTelangana relevance: 83%Agriculture relevance: 95%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1524ms)

Processing trail
  1. NORMALIZED · 10 Sept, 05:56
  2. RELEVANCE_ACCEPTED · 10 Sept, 05:56
  3. ENRICHED · 10 Sept, 05:56
  4. DEDUPED · 10 Sept, 05:57
  5. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 899e3492 · raw item 55a97f3f · origin live

YouTubeViswas Agri SolutionsDealer80%5 Feb, 20:09 IST
Jangaon (86% conf.)Telugu / Englishstance: neutral1,441 views · 12 likes · 1 comments

శ్రీ శివ శంకర్ ఎంటర్ప్రెసెస్&డ్రిప్ | SRI SIVA SHANKAR ENTERPRISES #jangaon #fertilizer #pesticides

Original — Telugu / English

శ్రీ శివ శంకర్ ఎంటర్ప్రెసెస్&డ్రిప్ | SRI SIVA SHANKAR ENTERPRISES

English · AI translation

Sri Siva Shankar Enterprises & Drip | SRI SIVA SHANKAR ENTERPRISES #jangaon #fertilizer #pesticides Sri Siva Shankar Enterprises & Drip | SRI SIVA SHANKAR ENTERPRISES

fertilizer-availabilityfarm-mechanisation
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions Sri Siva Shankar Enterprises & Drip and includes the hashtags #jangaon, #fertilizer, and #pesticides.” · confidence 88%

Sentiment: neutralStance toward government: neutralTelangana relevance: 68%Agriculture relevance: 86%Classification confidence: 85%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1523ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:27
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  18. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention e89bff6e · raw item a17f1074 · origin live

YouTubeRTV NalgondaMedia organisation96%30 Jan, 18:37 IST
Nalgonda (86% conf.)Telugustance: neutral966 views · 10 likes · 0 comments

రైతు భరోసా డబ్బులు వేయాలి ఎరువులు తెచ్చుకుంటాం..! | Farmers About Rythu Bharosa | RTV Nalgonda

Original — Telugu

రైతు భరోసా డబ్బులు వేయాలి ఎరువులు తెచ్చుకుంటాం..! | Farmers About Rythu Bharosa | RTV Nalgonda

Show full source text as published

రైతు భరోసా డబ్బులు వేయాలి ఎరువులు తెచ్చుకుంటాం..! | Farmers About Rythu Bharosa | RTV Nalgonda రైతు భరోసా డబ్బులు వేయాలి ఎరువులు తెచ్చుకుంటాం..! | Farmers About Rythu Bharosa | RTV Nalgonda #rythubharosa #cmrevanthreddy #farmers #rtvnalgonda ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

The Rythu Bharosa money should be deposited; we will buy fertilizers..! | Farmers About Rythu Bharosa | RTV Nalgonda

farmer-support-schemesfertilizer-availabilityrythu-bharosa-paymentrythu-bharosa
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers say they need Rythu Bharosa money to buy fertilizers.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 92%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4638ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:40
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:47
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 17 Sept, 21:03
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention f07ae84a · raw item 73a9156b · origin live

YouTubehmtv Telugu NewsMedia organisation99%20 Jan, 12:22 IST
Rajanna Sircilla (98% conf.)Telugu / Englishstance: neutral87 views · 0 likes · 0 comments
Was live

రాజన్న సిరిసిల్లలో నకిలీ ఎరువులు అమ్మకం.. | Rajanna Sircilla District | Fake Fertilizers | hmtv

Original — Telugu / English

Follow hmtv on: Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

Show full source text as published

రాజన్న సిరిసిల్లలో నకిలీ ఎరువులు అమ్మకం.. | Rajanna Sircilla District | Fake Fertilizers | hmtv రాజన్న సిరిసిల్లలో నకిలీ ఎరువులు అమ్మకం.. | Rajanna Sircilla District | Fake Fertilizers | hmtv #hmtv #rajannasirisilla #fertilizer #fakefertilizer #framers #latestnews Follow hmtv on: ► FB: https://www.facebook.com/hmtvnewslive ► Twitter: https://twitter.com/hmtvnewslive ► Instagram: https://www.instagram.com/hmtvnewsofficial/?hl=en ►Telegram: https://t.me/hmtvnewslive ► Watch hmtv Live: https://youtube.com/live/3JodH4xoqJs ► Subscribe to hmdgtl: https://www.youtube.com/@hmdgtl?sub_confirmation=1 ► For News in Telugu: http://www.hmtvlive.com/ ► For News in English: http://www.thehansindia.com ► Follow us on our Whatsapp Channel: https://whatsapp.com/channel/0029Va9MPsgCMY0AFP9BeE3n Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. 🔹 24/7 News 🔹 Politics & Current Affairs 🔹 Entertainment & Cinema 🔹 Sports Highlights 🔹 Cultural Stories & Folk Music 🔹 Documentaries & Features 🔹 Interviews & Insights 🔹 Thought-Provoking Debates & Conclaves hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332 Stay informed and engaged—subscribe to hmtv and never miss a beat! 🔔 Subscribe Now: http://goo.gl/f9lm5E

English · AI translation

Fake fertilizer sales in Rajanna Sircilla.. | Rajanna Sircilla District | Fake Fertilizers | hmtv Follow hmtv on: Stay Connected with hmtv – The Heartbeat of Telugu News! hmtv, Hyderabad’s trusted 24-hour Telugu news channel, delivers the most reliable and engaging updates tailored for audiences in Telangana, Andhra Pradesh, and beyond. Welcome to hmtv Live, your trusted source for 24-hour news coverage that keeps you informed, aware, and connected. We bring you in-depth journalism across a wide spectrum – from breaking news, political analysis, and sports to entertainment, celebrity interviews from all film industries, and exclusive documentaries. Our content goes beyond headlines, diving deep into the culture, heritage, and diversity of India, with a special focus on the Telugu-speaking states of Andhra Pradesh and Telangana. From grassroots issues to national affairs, from folk traditions to modern trends – we cover it all. hmtv Live is your one-stop destination for daily news, stories that matter, and voices that deserve to be heard. For Business Enquiries: 📞 +91 8096606332

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fake fertilizers are being sold in Rajanna Sircilla district.” · confidence 97%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2749ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:01
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 46d0a8f1 · raw item 3f10798e · origin live

YouTubeANN DigitalMedia organisation88%31 Dec, 19:36 IST
Adilabad (97% conf.)Telugu / Englishstance: supportive112 views · 1 likes · 0 comments

Adilabad : ఫెర్టిలైజర్ బుకింగ్ మొబైల్ యాప్‌పై హ‌ర్షం వ్యక్తంచేసిన రైతులు | Fertilizer Booking App

Original — Telugu / English

For more latest updates on the news : ► FacebookGroup :

Show full source text as published

Adilabad : ఫెర్టిలైజర్ బుకింగ్ మొబైల్ యాప్‌పై హ‌ర్షం వ్యక్తంచేసిన రైతులు | Fertilizer Booking App #telangananews #latestnews #anndigital Adilabad : ఫెర్టిలైజర్ బుకింగ్ మొబైల్ యాప్‌పై హ‌ర్షం వ్యక్తంచేసిన రైతులు | Fertilizer Booking App You are Watching ANN Telugu Live. It is a leading Telugu News Channel, bringing you the first account of all the latest news online from around the world including breaking news, regional news, national news, international news, sports updates, entertainment gossips, political news, crime reports. If you like this video, please don’t forget to subscribe and like, comment the ANN Telugu Live for more interesting updates and Trending Public videos. #ANNTELUGU #ANNTELUGUNEWS #ANNTeluguLive #ANN #AMMANEWS #BreakingNews #FlashNews #SpeedNews For more latest updates on the news : ► Subscribe to Amma News Channel: https://www.youtube.com/c/Ammanewslivev ► Like us on Facebook: https: https://www.facebook.com/Ammanewslive/ ► Follow us on Twitter : https://twitter.com/ammanews1 ► ShareChat : https://sharechat.com/profile/ammanewslive?referrer=copyLink ► FacebookGroup : https://www.facebook.com/groups/1813851678807723 ► Instagram : https://instagram.com/ammanewslive11?utm_medium=copy_link ► Koo APP https://www.kooapp.com/profile/AmmaNewsLive #Telangananews #Hyderabadnews #Adilabadnews #ammanews #ANNTELUGU #ANNTeluguLive #ANNTELUGUHD #ANNTeluguNewsChannel #TelanganaNews #APNews #AndhraPradeshNews #TeluguLiveUpdates #TeluguNewsLive #TeluguLive #LiveTV #TeluguNews #Telugunewslive #TeluguLive #TeluguNews #latesttelugunews #TeluguNewsChannel #LatestNews #telugu #TeluguBreakingNews #TSnews #TelanganaNews #TelanganaNews #AndhrapradeshNews #HyderabadNews #politicalnews #telanganapolitics

English · AI translation

Adilabad: Farmers expressed happiness over the fertilizer booking mobile app | Fertilizer Booking App For more latest updates on the news: ► FacebookGroup :

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Adilabad expressed happiness about the fertilizer booking mobile app.” · confidence 92%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 82%Agriculture relevance: 95%Classification confidence: 89%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2885ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:24
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention a52d7f5d · raw item 9d5ebb55 · origin live

YouTubePolitical NewsMedia organisation82%31 Dec, 12:38 IST
Kamareddy · tadwai (98% conf.)Telugustance: neutral2 views · 0 likes · 0 comments

ఎరువుల కోసం రైతులకు మళ్ళీ మొదలైన కష్టాలు కామారెడ్డి జిల్లా తాడ్వాయి మండలం ఎండ్రియాల్ గ్రామంలో..

Original — Telugu

ఎరువుల కోసం రైతులకు మళ్ళీ మొదలైన కష్టాలు కామారెడ్డి జిల్లా తాడ్వాయి మండలం ఎండ్రియాల్ గ్రామంలో..

English · AI translation

Farmers’ difficulties have started again for fertilizers in Endrial village, Tadwai mandal, Kamareddy district..

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Endrial village of Tadwai mandal in Kamareddy district are facing renewed difficulties in obtaining fertilizers.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2210ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention beaa1383 · raw item 1d53a4e2 · origin live

YouTubeHari KrishnaCreator78%29 Dec, 10:04 IST
Mahabubabad (86% conf.)Englishstance: neutral51 views · 4 likes · 0 comments

Telangana fertilizer application registration #india #telangana #farming #mahabubabad #nature

Original — English

Telangana fertilizer application registration

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions Telangana fertilizer application registration.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 96%Agriculture relevance: 88%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1630ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:39
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:40
  3. ENRICHED · 10 Sept, 19:41
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f99a422b · raw item 7d7817c7 · origin live

YouTubeSumanTV MahabubabadMedia organisation94%22 Dec, 13:25 IST
Mahabubabad (82% conf.)Englishstance: critical242 views · 2 likes · 1 comments

ఎరువుల బస్తాకు యాప్ ఎందుకయ్యా | KCR Questions Fertilizer App System | KCR Speech | fertilizer app

Original — English

Watch► ఎరువుల బస్తాకు యాప్ ఎందుకయ్యా | KCR Questions Fertilizer App System | KCR Speech | fertilizer app | @SumanTVMahabubabad BRS Party Chief K. Chandrashekar Rao (KCR) strongly criticized the Central Government over the mandatory app system for fertilizer distribution. KCR questioned: Why an app is needed to buy fertilizer bags How farmers without smartphones will manage Whether this system creates more trouble for farmers The lack of ground-level understanding by the Centre SumanTV Mahabubabad is an official YouTube Channel which will constantly keep you updated with the latest breaking news, trending topics, entertainment videos, viral videos, health and beauty tips, numerology tips and others. Stay updated with Tollywood latest happenings and other social media viral news exclusively on SumanTV Mahabubabad. SumanTV Mahabubabad provides complete information about the daily news updates and telugu film industry. SumanTV Mahabubabad is leading news/Media web channel providing exclusive daily updates and entertainment sector globally. Followed by leading celebrities & cinema lovers across the globe. The goal of SumanTV Mahabubabad is to provide breaking news from the daily updates and entertainment industry as it happens.

Show full source text as published

ఎరువుల బస్తాకు యాప్ ఎందుకయ్యా | KCR Questions Fertilizer App System | KCR Speech | fertilizer app #KCR #FertilizerApp #TelanganaFarmers #BRSParty #FarmerProblems #KCRSpeech Watch► ఎరువుల బస్తాకు యాప్ ఎందుకయ్యా | KCR Questions Fertilizer App System | KCR Speech | fertilizer app | @SumanTVMahabubabad BRS Party Chief K. Chandrashekar Rao (KCR) strongly criticized the Central Government over the mandatory app system for fertilizer distribution. KCR questioned: Why an app is needed to buy fertilizer bags How farmers without smartphones will manage Whether this system creates more trouble for farmers The lack of ground-level understanding by the Centre SumanTV Mahabubabad is an official YouTube Channel which will constantly keep you updated with the latest breaking news, trending topics, entertainment videos, viral videos, health and beauty tips, numerology tips and others. Stay updated with Tollywood latest happenings and other social media viral news exclusively on SumanTV Mahabubabad. SumanTV Mahabubabad provides complete information about the daily news updates and telugu film industry. SumanTV Mahabubabad is leading news/Media web channel providing exclusive daily updates and entertainment sector globally. Followed by leading celebrities & cinema lovers across the globe. The goal of SumanTV Mahabubabad is to provide breaking news from the daily updates and entertainment industry as it happens. Hope you like this video Please Subscribe our channel for more videos like this... Subscribe like share comment Thank you all @sumantv mahabubabad

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“KCR criticized the mandatory app system for fertilizer distribution and questioned why farmers need an app to buy fertilizer bags.” · confidence 96%

Sentiment: negativeStance toward government: criticalTelangana relevance: 80%Agriculture relevance: 90%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1981ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:40
  3. ENRICHED · 10 Sept, 19:43
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention d0d34b32 · raw item 49ecca6b · origin live

YouTubeRTV Media organisation95%22 Dec, 12:45 IST
Nizamabad (97% conf.)Telugustance: neutral2,044 views · 1 likes · 0 comments

తగినంత ఎరువులు లేక రైతుల ఇబ్బందులు | Farmers Comments On Fertilizers | Nizamabad | RTV

Original — Telugu

Brand Placment తగినంత ఎరువులు లేక రైతుల ఇబ్బందులు | Farmers Comments On Fertilizers | Nizamabad | RTV

Show full source text as published

తగినంత ఎరువులు లేక రైతుల ఇబ్బందులు | Farmers Comments On Fertilizers | Nizamabad | RTV Brand Placment తగినంత ఎరువులు లేక రైతుల ఇబ్బందులు | Farmers Comments On Fertilizers | Nizamabad | RTV ►For More News Updates, Visit : https://www.rtvlive.com ► Join Our Whats APP Channel : https://whatsapp.com/channel/0029Va9lQhBGk1Fr2DHRUO1U ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://apps.apple.com/in/app/rtv-live/id6466401505 About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguDigital/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Farmers are facing difficulties due to insufficient fertilizers | Farmers Comments On Fertilizers | Nizamabad | RTV Brand placement Farmers are facing difficulties due to insufficient fertilizers | Farmers Comments On Fertilizers | Nizamabad | RTV

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are facing difficulties due to insufficient fertilizers.” · confidence 95%

Sentiment: negativeStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 96%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1782ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 95366e59 · raw item a5f641b7 · origin live

YouTubeNews18 TeluguMedia organisation99%22 Dec, 09:40 IST
District not evidencedTelugu / Englishstance: neutral452 views · 1 likes · 2 comments

Fertilizer App | ఎరువుల కష్టాలకు స్వస్తీ.. ఇకనుండి మొబైల్ యాప్‌లో బుకింగ్! | #local18v

Original — Telugu / English

రైతులకు ఎరువుల సరఫరా సులభతరం చేయడానికి తెలంగాణ రాష్ట్ర ప్రభుత్వం రూపొందించిన ఫెర్టిలైజర్ యాప్ పై అవగాహన కార్యక్రమాలు నిర్వహించగా, రైతులు ఈ యాప్ ఉపయోగించి ఎరువులు సమయానుకూలంగా పొందవచ్చు. Awareness programs were held on Telangana government's Fertilizer App to help farmers easily access fertilizers, ensuring timely supply through the app.

Show full source text as published

Fertilizer App | ఎరువుల కష్టాలకు స్వస్తీ.. ఇకనుండి మొబైల్ యాప్‌లో బుకింగ్! | #local18v రైతులకు ఎరువుల సరఫరా సులభతరం చేయడానికి తెలంగాణ రాష్ట్ర ప్రభుత్వం రూపొందించిన ఫెర్టిలైజర్ యాప్ పై అవగాహన కార్యక్రమాలు నిర్వహించగా, రైతులు ఈ యాప్ ఉపయోగించి ఎరువులు సమయానుకూలంగా పొందవచ్చు. Awareness programs were held on Telangana government's Fertilizer App to help farmers easily access fertilizers, ensuring timely supply through the app. #fertilizers #tealangana #rajannasiricilla ----------------------------------------------------------------------------------------- Welcome to News18 Telugu, your ultimate destination for comprehensive coverage of breaking news and updates from Andhra Pradesh, Telangana, across India, and around the globe. Dive into our channel for the latest developments in politics, society, economy, and more. Stay tuned for exclusive insights into Tollywood, the pulse of regional cinema, along with updates on sports, entertainment, and beyond. Subscribe now to stay ahead with News18 Telugu Follow us: Subscribe: https://www.youtube.com/@News18Telugu Website: https://telugu.news18.com/ Whatsapp: https://whatsapp.com/channel/0029VaBicceHLHQaaV6fWs2N Facebook: https://www.facebook.com/News18Telugu/ Twitter: https://twitter.com/News18Telugu Instagram: https://www.instagram.com/news18telugu/ News18 Mobile App - https://onelink.to/desc-youtube

English · AI translation

Fertilizer App | End to fertilizer difficulties.. booking will now be available in the mobile app! | #local18v Awareness programs were held on the Telangana government's Fertilizer App to make fertilizer supply easier for farmers, and farmers can use this app to get fertilizers in a timely manner.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Telangana government conducted awareness programs about its Fertilizer App to help farmers book fertilizers through mobile phones.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2071ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention bbdd5851 · raw item ba25c408 · origin live

YouTubeFarmer BharathFarmer45%21 Dec, 19:39 IST
Suryapet (55% conf.)Englishstance: neutral6,823 views · 72 likes · 0 comments

Fertilizer Booking App🌾#trending #telugu #viral #farming #tsfarmers #agriculture #suryapet #bigboss

Original — English

Fertilizer Booking App🌾#trending

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions a fertilizer booking app.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 60%Agriculture relevance: 80%Classification confidence: 66%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1681ms)

Processing trail
  1. NORMALIZED · 11 Sept, 06:21
  2. RELEVANCE_ACCEPTED · 11 Sept, 06:21
  3. ENRICHED · 11 Sept, 06:22
  4. DEDUPED · 11 Sept, 06:22
  5. NARRATIVE_ASSIGNED · 11 Sept, 06:22
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 4bfa96d4 · raw item 111eff7d · origin live

YouTubeLokal VarthaMedia organisation86%20 Dec, 16:45 IST
Rajanna Sircilla (99% conf.)Telugustance: neutral3 views · 0 likes · 0 comments

రాజన్న సిరిసిల్ల జిల్లాలో ఎరువుల బుకింగ్ యాప్‌పై రైతులకు అవగాహన సదస్సు#localnews #latestnews

Original — Telugu

రాజన్న సిరిసిల్ల జిల్లాలో ఎరువుల బుకింగ్ యాప్‌పై రైతులకు అవగాహన సదస్సు#localnews #latestnews

Show full source text as published

రాజన్న సిరిసిల్ల జిల్లాలో ఎరువుల బుకింగ్ యాప్‌పై రైతులకు అవగాహన సదస్సు#localnews #latestnews రాజన్న సిరిసిల్ల జిల్లాలో ఎరువుల బుకింగ్ యాప్‌పై రైతులకు అవగాహన సదస్సు#RajannaSircilla #Telangana #FertilizerBookingApp #UreaBooking #SmartFarming #Agriculture #FarmersWelfare #DigitalAgriculture #SircillaNews #TelanganaFarmers #FarmingTechnology #NoQueues #FarmApp #RabiSeason #AgricultureNews #CropCare #RuralIndia #TechForFarmers #IndianAgriculture #FarmersSupport #SustainableFarming #DigitalIndia #AgriTech #FarmManagement #VillageNews

English · AI translation

An awareness meeting was held for farmers in Rajanna Sircilla district on the fertilizer booking app.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“An awareness meeting on the fertilizer booking app was held for farmers in Rajanna Sircilla district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 86%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2296ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 02:00
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention a2317a8b · raw item 726f6938 · origin live

YouTubeAVH TIMESMedia organisation84%19 Dec, 18:14 IST
Karimnagar (99% conf.)Telugu / Englishstance: neutral748 views · 2 likes · 0 comments

First Muneera Agrotech branch in Karimnagar | మీ పంటలకు అధిక దిగుబడి ఎరువులు || Avh Shorts

Original — Telugu / English

First Muneera Agrotech branch in Karimnagar | మీ పంటలకు అధిక దిగుబడి ఎరువులు || Avh Shorts

English · AI translation

First Muneera Agrotech branch in Karimnagar | Fertilizers for higher yield for your crops || Avh Shorts

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The first Muneera Agrotech branch is in Karimnagar.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 78%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1974ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:38
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention edc37df7 · raw item b070b074 · origin live

YouTubeaakeru NEWS TeluguMedia organisation92%11 Dec, 12:17 IST
Warangal (90% conf.)Telugu / Englishstance: neutral720 views · 14 likes · 0 comments

Gangadevipally | Human feces as organic Fertilizer | అదెట్లా ముట్టుకుంటామని ఇబ్బంది పెట్టారు...

Original — Telugu / English

#kusumrajamouli #gangadevipalli #modelvillage #warangal #ideal #telangana #youtube #trending #video #organicfertilizer #latestnews #news #election #𝐚𝐚𝐤𝐞𝐫𝐮𝐍𝐄𝐖𝐒𝐓𝐞𝐥𝐮𝐠𝐮 Gangadevipally | Human feces as organic Fertilizer | అదెట్లా ముట్టుకుంటామని ఇబ్బంది పెట్టారు...| 𝐚𝐚𝐤𝐞𝐫𝐮 𝐍𝐄𝐖𝐒 𝐓𝐞𝐥𝐮𝐠𝐮 𝐅𝐨𝐥𝐥𝐨𝐰 𝐮𝐬 𝐨𝐧:

Show full source text as published

Gangadevipally | Human feces as organic Fertilizer | అదెట్లా ముట్టుకుంటామని ఇబ్బంది పెట్టారు... #kusumrajamouli #gangadevipalli #modelvillage #warangal #ideal #telangana #youtube #trending #video #organicfertilizer #latestnews #news #election #𝐚𝐚𝐤𝐞𝐫𝐮𝐍𝐄𝐖𝐒𝐓𝐞𝐥𝐮𝐠𝐮 Gangadevipally | Human feces as organic Fertilizer | అదెట్లా ముట్టుకుంటామని ఇబ్బంది పెట్టారు...| 𝐚𝐚𝐤𝐞𝐫𝐮 𝐍𝐄𝐖𝐒 𝐓𝐞𝐥𝐮𝐠𝐮 𝐅𝐨𝐥𝐥𝐨𝐰 𝐮𝐬 𝐨𝐧: 𝐒𝐮𝐛𝐬𝐜𝐫𝐢𝐛𝐞 : https://bit.ly/3PNtdLZ 𝐘𝐨𝐮𝐭𝐮𝐛𝐞 : https://bit.ly/3S0hbAA 𝐀𝐚𝐤𝐞𝐫𝐮 𝐏𝐚𝐥𝐥𝐞𝐠𝐨𝐧𝐭𝐡𝐮𝐤𝐚 : https://bit.ly/411mrHO 𝐓𝐞𝐥𝐞𝐠𝐫𝐚𝐦: https://t.me/aakeru_news_official 𝐈𝐧𝐬𝐭𝐚𝐠𝐫𝐚𝐦: https://www.instagram.com/aakeru_news/ 𝐓𝐰𝐢𝐭𝐭𝐞𝐫:https://twitter.com/aakerunews

English · AI translation

Gangadevipally | Human feces as organic fertilizer | They caused trouble saying how can we even touch it... Gangadevipally | Human feces as organic fertilizer | They caused trouble saying how can we even touch it...

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content says Gangadevipally uses human feces as organic fertilizer.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 72%Classification confidence: 79%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2221ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:27
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 8a636162 · raw item 00887693 · origin live

Near-duplicateYouTubeaakeru NEWS Telugu11 Dec, 12:46 ISTnot counted toward volume

Gangadevipally | చెంబులు పట్టుకుని బయటకు వస్తే పట్టుకునే వాళ్లం | Human feces as organic Fertilizer

YouTubeT News teluguMedia organisation96%25 Nov, 20:15 IST
Warangal (95% conf.)Englishstance: neutral92 views · 0 likes · 0 comments

Farmers Queue Line For Year At Fertilizer Center | Warangal | T News

Original — English

Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now!

Show full source text as published

Farmers Queue Line For Year At Fertilizer Center | Warangal | T News #Telugu #TnewsLive #Telangana Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now! Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://bit.ly/4ou8ui4 ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers queue for a year at a fertilizer center in Warangal.” · confidence 93%

Sentiment: negativeStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 88%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1620ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:24
  3. ENRICHED · 11 Sept, 20:27
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 18ee4f0a · raw item 1920ff4f · origin live

YouTubeAbhinav Bharath - TelanganaMedia organisation86%25 Oct, 10:15 IST
Kamareddy (98% conf.)Telugustance: critical782 views · 3 likes · 0 comments

బోనస్ ఇవ్వండి..ఎరువుల రేట్లు తగ్గించండి | Kamareddy Farmer Request To CM Revanth Reddy | #shorts

Original — Telugu

Kamareddy Farmer Request To CM Revanth Reddy | #shorts

Show full source text as published

బోనస్ ఇవ్వండి..ఎరువుల రేట్లు తగ్గించండి | Kamareddy Farmer Request To CM Revanth Reddy | #shorts #abnews #kamareddy #telanganafarmers #cmrevanthreddy #congressgovt #latestnews Kamareddy Farmer Request To CM Revanth Reddy | #shorts For more socio-political and awareness videos, please do SUBSCRIBE Abhinav Bharath Follow us on : ( Facebook ) : https://www.facebook.com/abhinavbharathtelugu ( Instagram ) : https://www.instagram.com/abhinavbharath_/ ( LinkedIn ) : https://www.linkedin.com/company/104429554/admin/dashboard/ ( Twitter ) : https://twitter.com/abhinav_bhrt To report any of your Social & Political issues... Download App : https://onelink.to/d6mcds

English · AI translation

Give a bonus.. reduce fertilizer prices | Kamareddy Farmer Request To CM Revanth Reddy | #shorts Kamareddy Farmer Request To CM Revanth Reddy | #shorts

farmer-support-schemesfertilizer-availabilityinput-cost
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A Kamareddy farmer is requesting Chief Minister Revanth Reddy to give a bonus and reduce fertilizer prices.” · confidence 96%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1914ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:45
  7. NARRATIVE_ASSIGNED · 16 Sept, 14:45
  8. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  9. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  10. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  11. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  12. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  14. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  15. NARRATIVE_ASSIGNED · 23 Sept, 02:43
  16. NARRATIVE_ASSIGNED · 23 Sept, 13:03

mention 3288262c · raw item 71d9a92a · origin live

YouTubeCOMPETITIVE WORLD - TSPSC - Dr.PADALA THIRUPATHI Creator73%25 Oct, 07:24 IST
Karimnagar (98% conf.)Englishstance: neutral1,367 views · 15 likes · 0 comments

Applying fertilizers to the saplings in SRR GOVERNMENT ARTS AND SCIENCE COLLEGE (A) KARIMNAGAR

Original — English

Applying fertilizers to the saplings in SRR GOVERNMENT ARTS AND SCIENCE COLLEGE (A) KARIMNAGAR

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizers are being applied to saplings at SRR Government Arts and Science College (A) in Karimnagar.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 78%Agriculture relevance: 67%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2043ms)

Processing trail
  1. NORMALIZED · 10 Sept, 05:56
  2. RELEVANCE_ACCEPTED · 10 Sept, 05:56
  3. ENRICHED · 10 Sept, 05:57
  4. DEDUPED · 10 Sept, 05:57
  5. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention c727c9bd · raw item 9121a37a · origin live

YouTubeRTV TrendMedia organisation91%11 Oct, 12:02 IST
Siddipet · gajwel (94% conf.)Telugu / Englishstance: neutral310 views · 5 likes · 0 comments

Task Force Police Atta*cks Worker in Gajwel Fertilizer Shop | RTV Medak

Original — Telugu / English

గజ్వేల్ ఫర్టిలైజర్ షాప్ లో యువకుడిపై టాస్క్ ఫోర్స్ పోలీసులు దా*డి | Task Force Police Atta*cks Worker in Gajwel Fertilizer Shop | RTV Medak

Show full source text as published

Task Force Police Atta*cks Worker in Gajwel Fertilizer Shop | RTV Medak గజ్వేల్ ఫర్టిలైజర్ షాప్ లో యువకుడిపై టాస్క్ ఫోర్స్ పోలీసులు దా*డి | Task Force Police Atta*cks Worker in Gajwel Fertilizer Shop | RTV Medak #taskforcepolice #gajwel #fertilizershop #rtvmedak

English · AI translation

Task Force police attack a young man in a fertilizer shop in Gajwel | RTV Medak

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A task force police officer attacked a worker in a fertilizer shop in Gajwel.” · confidence 88%

Sentiment: negativeStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 85%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1611ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:34
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 1ad2d295 · raw item 5d58d161 · origin live

YouTubeUdayasree BikumallaDealer86%18 Sept, 23:35 IST
Mahabubabad (97% conf.)Englishstance: neutral467 views · 3 likes · 0 comments

Mrugashira Fertilizers & pesticides, Mahabubabad,for details comment. @udayasreebikumalla111

Original — English

Mrugashira Fertilizers & pesticides, Mahabubabad,for details comment. @udayasreebikumalla111

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Mrugashira Fertilizers & pesticides is in Mahabubabad.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 95%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1981ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:40
  3. ENRICHED · 10 Sept, 19:43
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention af7438a3 · raw item 372dfa6f · origin live

YouTubeT News teluguMedia organisation96%17 Sept, 12:45 IST
Bhadradri Kothagudem (96% conf.)Englishstance: neutral351 views · 0 likes · 0 comments

Women Farmers Queue For Shortage At Fertilizer Center | Bhadradri Kothagudem | T News

Original — English

Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now!

Show full source text as published

Women Farmers Queue For Shortage At Fertilizer Center | Bhadradri Kothagudem | T News #Telugu #TnewsLive #Telangana Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now! Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://bit.ly/4ioUBxV ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Women farmers are queuing at a fertilizer center due to a shortage in Bhadradri Kothagudem.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 98%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1637ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:35
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:36
  3. ENRICHED · 9 Sept, 22:39
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention d2afd4f6 · raw item 1de86c8c · origin live

YouTubeGnana TelanganaMedia organisation68%9 Sept, 05:51 IST
District not evidencedTelugustance: neutral1,489 views · 12 likes · 0 comments

ఎరువుల కొరత ఉన్నది వాస్తవం

Original — Telugu

ఎరువుల కొరత ఉన్నది వాస్తవం

English · AI translation

There is a shortage of fertilizers; that is a fact.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a shortage of fertilizers.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 60%Agriculture relevance: 95%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1724ms)

Processing trail
  1. NORMALIZED · 8 Sept, 23:50
  2. RELEVANCE_ACCEPTED · 8 Sept, 23:51
  3. ENRICHED · 8 Sept, 23:54
  4. DEDUPED · 8 Sept, 23:55
  5. NARRATIVE_ASSIGNED · 8 Sept, 23:56
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 652f50f3 · raw item 5f3dad1d · origin live

YouTubeZ6 News TeluguMedia organisation94%8 Sept, 15:58 IST
District not evidencedTelugustance: critical2,076 views · 9 likes · 0 comments

ఎరువుల కొరత రాష్ట్ర ప్రభుత్వాన్ని కాదు l పార్టీ అధ్యక్షులు ఇంద్రసేనారెడ్డి l Z6tvNews #telangana

Original — Telugu

#telangana # కాంగ్రెస్ పార్టీ ఆధ్వర్యంలో జాతీయ రహదారిపై ధర్నా రాస్తారోకో l#newsarticles #telangana # Congress Party#newsstories

English · AI translation

Fertilizer shortage is not the state government's fault | Party president Indrasena Reddy | Z6tvNews #telangana #telangana # Under the leadership of the Congress party, a dharna and road blockade on the national highway | #newsarticles #telangana # Congress Party #newsstories

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer shortage, and a protest/blockade was held on a national highway under the Congress party's leadership.” · confidence 83%

Sentiment: negativeStance toward government: criticalTelangana relevance: 98%Agriculture relevance: 72%Classification confidence: 84%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2690ms)

Processing trail
  1. NORMALIZED · 8 Sept, 23:50
  2. RELEVANCE_ACCEPTED · 8 Sept, 23:51
  3. ENRICHED · 8 Sept, 23:52
  4. DEDUPED · 8 Sept, 23:55
  5. NARRATIVE_ASSIGNED · 8 Sept, 23:56
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention a6a3ce4b · raw item fc9d8770 · origin live

YouTubeMana 9Tv NewsMedia organisation98%8 Sept, 15:23 IST
District not evidencedTelugustance: neutral1,009 views · 4 likes · 0 comments

🌾 ఎరువుల కొరత నిజమే..! | మంత్రి పొన్నం ప్రభాకర్ క్లారిటీ | Mana9tv News

Original — Telugu

Welcome to the official Mana 9Tv Cable Tv and YouTube channel. Mana 9 Tv is Telugu News Channel which covers 24/7 of Politics, Sports, Health, Entertainment, News updates from Telangana and Andhra Pradesh. Mana 9 Tv presents the complete picture of news stories happening in and around both the Telugu states as well as in our country. Mana 9 tv is running by a team of well experienced and dynamic journalists having well social world outlook. We Updates Daily different types of News and Special Programs, Interviews, Cultural events and also different types of issues debates.

Show full source text as published

🌾 ఎరువుల కొరత నిజమే..! | మంత్రి పొన్నం ప్రభాకర్ క్లారిటీ | Mana9tv News #ఎరువులకొరత #PonnamPrabhakar #TelanganaNews #BreakingNews #FarmersIssues #Agriculture #రైతులు #TelanganaPolitics #ManaTelangana #telugunewsupdates #mana9tv #mana9tvnews Welcome to the official Mana 9Tv Cable Tv and YouTube channel. Mana 9 Tv is Telugu News Channel which covers 24/7 of Politics, Sports, Health, Entertainment, News updates from Telangana and Andhra Pradesh. Mana 9 Tv presents the complete picture of news stories happening in and around both the Telugu states as well as in our country. Mana 9 tv is running by a team of well experienced and dynamic journalists having well social world outlook. We Updates Daily different types of News and Special Programs, Interviews, Cultural events and also different types of issues debates. #Telangana #Andhra #Politics #Sports #Health #Entertainment #TeluguNewsupdates#Mana9tv #TeluguNewsChannel #UpdateNews Follow Us on: Facebook: https://www.facebook.com/mana9tv Twitter: https://twitter.com/mana9tv Instagram: https://www.instagram.com/mana9tv/

English · AI translation

🌾 The fertilizer shortage is real..! | Minister Ponnam Prabhakar clarification | Mana9tv News Welcome to the official Mana 9Tv Cable TV and YouTube channel. Mana 9 Tv is a Telugu news channel which covers 24/7 politics, sports, health, entertainment, and news updates from Telangana and Andhra Pradesh. Mana 9 Tv presents the complete picture of news stories happening in and around both the Telugu states as well as in our country. Mana 9 tv is run by a team of highly experienced and dynamic journalists with a broad social outlook. We provide daily updates on different types of news and special programs, interviews, cultural events, and also different types of issue debates.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content says there is a real shortage of fertilizers and mentions Minister Ponnam Prabhakar's clarification.” · confidence 74%

Sentiment: neutralStance toward government: neutralTelangana relevance: 78%Agriculture relevance: 72%Classification confidence: 77%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2671ms)

Processing trail
  1. NORMALIZED · 8 Sept, 23:50
  2. RELEVANCE_ACCEPTED · 8 Sept, 23:51
  3. ENRICHED · 8 Sept, 23:52
  4. DEDUPED · 8 Sept, 23:55
  5. NARRATIVE_ASSIGNED · 8 Sept, 23:56
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 811ef671 · raw item 2450445a · origin live

YouTubeThe Federal TelanganaMedia organisation92%8 Sept, 13:51 IST
District not evidencedTelugustance: critical994 views · 7 likes · 0 comments

ఎరువుల కొరత ఉన్న మాట వాస్తవం.! #ponnamprabhakar #telanganapolitics #ytshorts #news #revanthreddy

Original — Telugu

ఎరువుల కొరత ఉన్న మాట వాస్తవం.!

English · AI translation

There is indeed a shortage of fertilizers.! #ponnamprabhakar #telanganapolitics #ytshorts #news #revanthreddy There is indeed a shortage of fertilizers.!

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer shortage.” · confidence 92%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2120ms)

Processing trail
  1. NORMALIZED · 8 Sept, 23:50
  2. RELEVANCE_ACCEPTED · 8 Sept, 23:51
  3. ENRICHED · 8 Sept, 23:52
  4. DEDUPED · 8 Sept, 23:55
  5. NARRATIVE_ASSIGNED · 8 Sept, 23:56
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention cc94c83e · raw item c07d95f9 · origin live

YouTubeTMC MEDIAMedia organisation92%6 Sept, 17:23 IST
Mahabubabad · mahabubabad (87% conf.)Telugu / Englishstance: critical2 views · 1 likes · 0 comments

మహబూబాబాద్ మండలం లో మన గ్రోమోర్ ఎరువుల దుకాణం తెరవలేదని దుకాణం ఎదుట మంట పెట్టి రైతుల నిరసన

Original — Telugu / English

Welcome to Thirumala News – Your Trusted Source for Medak District Updates Stay connected with the latest happenings in Medak, Telangana, through our comprehensive news coverage. From local events and political developments to community stories and cultural insights, Thirumala News brings you timely and relevant content in Telugu. తిరుమల న్యూస్ - మెదక్ మీ మెదక్ జిల్లా న్యూస్, విశ్లేషణలు, మరియు తాజా అప్డేట్స్ మీరు మెదక్ జిల్లాలో నివసిస్తున్నారా?

Show full source text as published

మహబూబాబాద్ మండలం లో మన గ్రోమోర్ ఎరువుల దుకాణం తెరవలేదని దుకాణం ఎదుట మంట పెట్టి రైతుల నిరసన Welcome to Thirumala News – Your Trusted Source for Medak District Updates Stay connected with the latest happenings in Medak, Telangana, through our comprehensive news coverage. From local events and political developments to community stories and cultural insights, Thirumala News brings you timely and relevant content in Telugu. తిరుమల న్యూస్ - మెదక్ మీ మెదక్ జిల్లా న్యూస్, విశ్లేషణలు, మరియు తాజా అప్డేట్స్ మీరు మెదక్ జిల్లాలో నివసిస్తున్నారా? మీరు మెదక్ జిల్లాలో జరిగే తాజా సంఘటనలు, రాజకీయ పరిణామాలు, గ్రామీణ అభివృద్ధి, ఆరోగ్య, విద్య, వ్యవసాయం, మరియు ఇతర ప్రాంతీయ వార్తలను తెలుసుకోవాలనుకుంటున్నారా? అయితే, తిరుమల న్యూస్ - మెదక్ ఛానెల్ మీకు కావలసిన సమాధానం #thirumala #medaknewschannel #medak #localnews #telangana #telangananews #telugunews #telanganapolitics

English · AI translation

Farmers protested by setting fire in front of the shop because the Man Gromore fertilizer shop in Mahabubabad mandal was not opened. Welcome to Thirumala News – Your Trusted Source for Medak District Updates Stay connected with the latest happenings in Medak, Telangana, through our comprehensive news coverage. From local events and political developments to community stories and cultural insights, Thirumala News brings you timely and relevant content in Telugu. Thirumala News - Medak Your Medak district news, analysis, and latest updates Do you live in Medak district?

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers protested in front of a Man Gromore fertilizer shop in Mahabubabad mandal because it was not opened.” · confidence 96%

Sentiment: negativeStance toward government: criticalTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2465ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention aa3f0c22 · raw item a4cabd8f · origin live

YouTubeCVR English OfficialMedia organisation98%30 Aug, 18:37 IST
Warangal (99% conf.)Englishstance: neutral14 views · 0 likes · 0 comments

Fertilizer Crisis Hits Farmers in Warangal District |CVR English

Original — English

CVR News English is one of the Largest Content producing English News channels in India. It's one of the leaders in producing and broadcasting unbiased and comprehensive news. CVR News English offers round-the-clock coverage of the latest breaking news and a unique mix of news bulletins, current affairs, and entertainment programs.

Show full source text as published

Fertilizer Crisis Hits Farmers in Warangal District |CVR English Fertilizer Crisis Hits Farmers in Warangal District |CVR English #cvrenglish #cvrnews #cvrenglish #cvrenglishchannel #warangal #farmers #fertilizer #cvrenglish CVR News English is one of the Largest Content producing English News channels in India. It's one of the leaders in producing and broadcasting unbiased and comprehensive news. ►Subscribe to CVR English LIVE: https://bit.ly/3uxDS4b ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX ►Visit us: https://cvrinfo.com/englishnews.html ►Like us on Facebook: https://www.facebook.com/cvrenglishnews ►Follow us On Instagram: https://www.instagram.com/cvrenglishnews/ ►Follow us on Twitter: https://twitter.com/cvrenglishnews CVR News English offers round-the-clock coverage of the latest breaking news and a unique mix of news bulletins, current affairs, and entertainment programs. CVR News Youtube Channels offers Latest News from India, Telugu States, Politics, Entertainment, Health, Sports Lifestyle, Devotional, National News, International News, and a lot more.! Stay tuned for all the breaking news in English!

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer crisis hits farmers in Warangal District.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 96%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1483ms)

Processing trail
  1. NORMALIZED · 11 Sept, 20:23
  2. RELEVANCE_ACCEPTED · 11 Sept, 20:25
  3. ENRICHED · 11 Sept, 20:29
  4. DEDUPED · 11 Sept, 20:29
  5. NARRATIVE_ASSIGNED · 11 Sept, 20:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention e24b28ab · raw item d598b39d · origin live

YouTubeDK TIMES Media organisation95%25 Aug, 14:33 IST
Nagarkurnool (97% conf.)Telugustance: neutral13 views · 0 likes · 0 comments

నాగర్ కర్నూల్ జిల్లాలో నాసిరకం ఎరువులను ఇస్తున్నారంటూ కలెక్టరేట్ వద్ద రైతుల ఆందోళన #nagarkurnool

Original — Telugu

DK TIMES is a dynamic YouTube channel covering news from Telangana. Known for its independent and innovative approach, the channel delivers accurate and factual content, breaking news, political analysis, and film industry DK TIMES also provides live reports Committed to unbiased reporting, DK TIMES aims to be a reliable source for the latest and most comprehensive stories from both Telugu states.

Show full source text as published

నాగర్ కర్నూల్ జిల్లాలో నాసిరకం ఎరువులను ఇస్తున్నారంటూ కలెక్టరేట్ వద్ద రైతుల ఆందోళన #nagarkurnool DK TIMES is a dynamic YouTube channel covering news from Telangana. Known for its independent and innovative approach, the channel delivers accurate and factual content, breaking news, political analysis, and film industry DK TIMES also provides live reports The channel is a one-stop destination for updates on politics, sports, entertainment, business, science, and technology. Committed to unbiased reporting, DK TIMES aims to be a reliable source for the latest and most comprehensive stories from both Telugu states. For more updates about Tollywood and Celebrities, subscribe to our Youtube channel. / @dktimes Subscribe and click the bell icon to never miss an update.

English · AI translation

Farmers are protesting at the collectorate in Nagarkurnool district, alleging that substandard fertilizers are being distributed. #nagarkurnool

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers protested at the collectorate in Nagarkurnool district alleging that substandard fertilizers are being distributed.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2917ms)

Processing trail
  1. NORMALIZED · 10 Sept, 19:40
  2. RELEVANCE_ACCEPTED · 10 Sept, 19:41
  3. ENRICHED · 10 Sept, 19:43
  4. DEDUPED · 10 Sept, 19:43
  5. NARRATIVE_ASSIGNED · 10 Sept, 19:44
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention abf080dc · raw item b0082fbd · origin live

YouTubeCVR News TeluguMedia organisation96%23 Aug, 20:51 IST
Mulugu (98% conf.)Telugustance: neutral10,177 views · 25 likes · 0 comments

ఎరువులు, ఇందిరమ్మ ఇళ్ల కోసం ములుగులో మంత్రి సీతక్కని నిలదీసిన మహిళలు | CVR NEWS

Original — Telugu

"CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

ఎరువులు, ఇందిరమ్మ ఇళ్ల కోసం ములుగులో మంత్రి సీతక్కని నిలదీసిన మహిళలు | CVR NEWS #seetakka #mulugu #indirammaillu #urea #women #cmrevanthreddy #telangana #cvrnews #viralshorts ఎరువులు, ఇందిరమ్మ ఇళ్ల కోసం ములుగులో మంత్రి సీతక్కని నిలదీసిన మహిళలు | CVR NEWS "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Subscribe now and hit the notification bell to never miss out on any important updates. Join us as we strive to keep you informed and empowered with all types of news from Telangana and Andhra Pradesh. CVR News - Your trusted source for credible news coverage. ►Subscribe to CVR News LIVE : https://www.youtube.com/live/20VSueeKx4Q?si=eBnK6R3S6wAwlgyq ►Subscribe to CVR News Telugu: https://bit.ly/3IAq9Pi ►Visit us: https://cvrnews.net/ ►Like us on Facebook: https://www.facebook.com/cvrnewsteluguofficial ►Follow us On Instagram: https://www.instagram.com/cvrnewsofficial?igsh=ZHB2NXF6a3BpZjg2 ►Follow us on Twitter: https://twitter.com/cvrtelugunews ►Subscribe to CVR English Official: https://bit.ly/3JHUPj3 ►Subscribe to OM CVR: https://bit.ly/36O4oyn ►Subscribe to CVR Health: https://bit.ly/3urW9zX #CVRNews #TelanganaNews #APNews #RegionalNews #LocalUpdates #BreakingNews #CurrentAffairs #StateUpdates #HyderabadNews #AndhraPradeshUpdates #TeluguNews #PoliticalNews #EconomicUpdates #SocialIssues #TechnologyNews

English · AI translation

Women in Mulugu questioned Minister Seethakka over fertilizers and Indiramma houses | CVR NEWS "CVR News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, CVR News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

fertilizer-availabilityfarmer-support-schemes
Open original source ↗
AI interpretation & provenance
Extracted claim

“Women in Mulugu questioned Minister Seethakka about fertilizers and Indiramma houses.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 70%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2923ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:45
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  12. NARRATIVE_ASSIGNED · 23 Sept, 02:44
  13. NARRATIVE_ASSIGNED · 23 Sept, 13:04

mention 0b5b0e8d · raw item efeaa22c · origin live

YouTubeA1TV Telugu NewsMedia organisation97%23 Aug, 13:56 IST
Medak (98% conf.)Telugustance: critical21 views · 1 likes · 0 comments

మెదక్ : ఎరువుల కేంద్రం వద్ద బీఆర్‌ఎస్ నాయకుల ధర్నా

Original — Telugu

Welcome to A1 TV Telugu!

Show full source text as published

మెదక్ : ఎరువుల కేంద్రం వద్ద బీఆర్‌ఎస్ నాయకుల ధర్నా Welcome to A1 TV Telugu! Your go-to channel for the latest news, updates, and insightful stories from Andhra Pradesh and Telangana. We bring you breaking news, in-depth analysis, political updates, social issues, cultural events, and more, all in Telugu. Stay informed and connected with daily uploads that keep you ahead of the curve. Subscribe and hit the bell icon to never miss an update! #TeluguNews #AndhraPradesh #Telangana #A1TVTelugu #BreakingNews #PoliticalUpdates #CulturalEvents #live #telugunewschannels

English · AI translation

Medak: BRS leaders stage a dharna at a fertilizer center Welcome to A1 TV Telugu!

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“BRS leaders staged a dharna at a fertilizer center in Medak.” · confidence 95%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 80%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1933ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:42
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 6a2382dc · raw item 6041d8d0 · origin live

YouTubeS6 News WarangalMedia organisation95%22 Aug, 17:10 IST
Warangal (84% conf.)Telugustance: critical166 views · 0 likes · 0 comments

ఎరువులు ఇవ్వండి లేకపోతే క్షమాపణ చెప్పండి - మంత్రి పొన్నం BJPపై కౌంటర్ | S6 News Warangal

Original — Telugu

ఎరువులు ఇవ్వండి లేకపోతే క్షమాపణ చెప్పండి - మంత్రి పొన్నం BJPపై కౌంటర్ | S6 News Warangal

Show full source text as published

ఎరువులు ఇవ్వండి లేకపోతే క్షమాపణ చెప్పండి - మంత్రి పొన్నం BJPపై కౌంటర్ | S6 News Warangal ఎరువులు ఇవ్వండి లేకపోతే క్షమాపణ చెప్పండి - మంత్రి పొన్నం BJPపై కౌంటర్ | S6 News Warangal #మంత్రి_పొన్నం #TelanganaFarmers #HanmakondaNews #BJPVsCongress #FertilizerIssue #PonnamSpeech #HusnabadProject #VeerlagaddaThanda #TelanganaPolitics #KaluvulaNirmanam #s6newswarangal Ponnam Prabhakar speech, Telangana farmers news, BJP vs Congress Telangana, Hanmakonda political news, Bheemadevarapally news, Husnabad project updates, Telangana fertilizer issue, Veerlagadda Thanda news, Telangana irrigation canals, Ponnam demand BJP, Telangana political updates 2025

English · AI translation

Provide fertilizers or else apologize - Minister Ponnam counters BJP | S6 News Warangal Provide fertilizers or else apologize - Minister Ponnam counters BJP | S6 News Warangal

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Minister Ponnam told the BJP to provide fertilizers or apologize.” · confidence 78%

Sentiment: mixedStance toward government: criticalTelangana relevance: 86%Agriculture relevance: 74%Classification confidence: 79%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1746ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention d15c6be5 · raw item af8f8751 · origin live

YouTubeBIG TV MedakMedia organisation90%22 Aug, 14:34 IST
Medak (72% conf.)Telugustance: neutral182 views · 4 likes · 0 comments

ఎవరూ ఆగం కాకండి..! ఎరువులు అందరికి అందిస్తాం | Minister Ponnam Prabhakar | BIG TV

Original — Telugu

For latest Medak Updates Join Whatsapp Click Here ------⬇️⬇️ Big TV Telugu is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content.

Show full source text as published

ఎవరూ ఆగం కాకండి..! ఎరువులు అందరికి అందిస్తాం | Minister Ponnam Prabhakar | BIG TV ఎవరూ ఆగం కాకండి..! ఎరువులు అందరికి అందిస్తాం | Minister Ponnam Prabhakar | BIG TV #bigtvmedak #latestnews #medak #ministerponnamprabhakar For latest Medak Updates Join Whatsapp Click Here ------⬇️⬇️ https://chat.whatsapp.com/J1oMYrFQSLlEIwqe4hzSnk Big TV Telugu is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content. Connect with Us: 👉 Website: https://www.bigtvlive.com/ 👉 Facebook: https://www.facebook.com/BIGTVDigitalNews 👉 Twitter: https://x.com/bigtvtelugu 👉 WhatsApp: https://whatsapp.com/channel/0029VaAe49e72WTw8YM6zr3q 👉 Instagram: https://www.instagram.com/bigtv_telugu Subscribe to Big TV Telugu for your dose of authentic, unfiltered Telugu content. Hit the bell icon to never miss an update. Let's grow together as the most informed community in Telugu politics and beyond!

English · AI translation

Don’t panic..! We will supply fertilizers to everyone | Minister Ponnam Prabhakar | BIG TV For latest Medak Updates Join Whatsapp Click Here ------⬇️⬇️ Big TV Telugu is your go-to destination for the latest in Telugu politics, current affairs, breaking news, exclusive political interviews, and in-depth analysis from the heart of Telangana, Andhra Pradesh, and beyond. Beyond politics, we touch on social issues, entertainment, and much more, keeping you entertained and informed. Be the first to know with our quick updates and deep dives into political scenarios. Join discussions, ask questions, and engage directly with us through comments and live sessions. Our commitment to quality journalism ensures you get accurate, timely, and insightful content.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Minister Ponnam Prabhakar said that fertilizers will be provided to everyone.” · confidence 83%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 84%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3046ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:42
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 18d48894 · raw item 66194fc0 · origin live

YouTubeT News teluguMedia organisation96%21 Aug, 13:06 IST
Nalgonda (99% conf.)Telugustance: neutral341 views · 2 likes · 0 comments

ఎరువుల కోసం నానా తిప్పలు పడుతున్న రైతులు | Nalgonda | T News

Original — Telugu

Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now!

Show full source text as published

ఎరువుల కోసం నానా తిప్పలు పడుతున్న రైతులు | Nalgonda | T News #Telugu #TnewsLive #Telangana Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana & etc.. Get current news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now! Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://bit.ly/4ioUBxV ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

English · AI translation

Farmers are facing many difficulties for fertilizers | Nalgonda | T News Farmers are facing many difficulties for fertilizers | Nalgonda | T News Stay updated with the latest Telugu news, breaking news, and trending stories from Telangana and etc.. Get current Telugu news on politics, cinema, and sports, and stay informed. Watch this video for the latest Telugu news right now!

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are struggling to get fertilizers in Nalgonda.” · confidence 88%

Sentiment: negativeStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 92%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2449ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 3148b760 · raw item e84d7ef6 · origin live

YouTubepavanasutha traders MakkarajpetDealer87%20 Aug, 19:29 IST
Medak · chegunta (86% conf.)Englishstance: neutral156 views · 5 likes · 0 comments

#coromandel #gromo #20:20:0;13#chegunta #medak #fome #fertilizer #shop #makkarajpet #pavanasutha

Original — English

#coromandel #gromo #20:20:0;13#chegunta #medak #fome #fertilizer #shop #makkarajpet #pavanasutha

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The post mentions Coromandel fertilizer and Gromo 20:20:0;13 at a fertilizer shop in Makkarajpet, Chegunta, Medak.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 72%Agriculture relevance: 92%Classification confidence: 82%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1587ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:33
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 2a5b447c · raw item 103330fb · origin live

YouTubepavanasutha traders MakkarajpetDealer87%20 Aug, 19:13 IST
Medak (63% conf.)Englishstance: neutral241 views · 6 likes · 0 comments

all varieties fertilizer available#mop #krichmedia #zypp #narmada #fome #promo #chegunta #medak

Original — English

all varieties fertilizer available#mop

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“All varieties of fertilizer are available.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 82%Agriculture relevance: 98%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1473ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:31
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:35
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 2427dd78 · raw item 0a2b3d28 · origin live

YouTubeindia6tvMedia organisation93%20 Aug, 18:33 IST
Medak (99% conf.)Telugustance: neutral864 views · 1 likes · 0 comments

మెదక్ జిల్లాలో ఎరువుల కొరత లేకుండా చర్యలు తీసుకుంటున్నామని జిల్లా కలెక్టర్ రాహుల్ రాజ్ తెలిపారు

Original — Telugu

మెదక్ జిల్లాలో ఎరువుల కొరత లేకుండా చర్యలు తీసుకుంటున్నామని జిల్లా కలెక్టర్ రాహుల్ రాజ్ తెలిపారు

English · AI translation

District Collector Rahul Raj stated that measures are being taken to ensure there is no fertilizer shortage in Medak district.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“District Collector Rahul Raj said that measures are being taken to ensure there is no fertilizer shortage in Medak district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 92%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1980ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:42
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention aa730843 · raw item 10112670 · origin live

YouTube6TVMedia organisation98%19 Aug, 16:40 IST
Mahabubabad (98% conf.)Telugu / Englishstance: neutral61 views · 0 likes · 0 comments

మహబూబాబాద్ జిల్లాలో ఎరువుల సంక్షోభం: రైతులకు దెబ్బ|Fertilizer Crisis Hits Mahabubabad Farmers|@6TV

Original — Telugu / English

మహబూబాబాద్ జిల్లాలో ఎరువుల సంక్షోభం: రైతులకు దెబ్బ|Fertilizer Crisis Hits Mahabubabad Farmers| ⁨@6TV⁩ ​ Stay Informed with 6tv Telugu News Live Whether you are a resident of Telugu-speaking regions or simply have an interest in Telugu news and culture, 6tv Telugu News Live is the perfect source of information for you. Stay informed, stay engaged, and stay connected with 6tv Telugu News Live. Tune in today and experience the difference that quality news coverage can make in your life. In conclusion, 6tv Telugu News Live is your go-to source for all things Telugu news. With live coverage, expert analysis, and unbiased reporting, 6tv Telugu News Live ensures that you stay informed and up-to-date on the latest happenings. Don't miss out on important news updates - tune in to 6tv Telugu News Live today!

Show full source text as published

మహబూబాబాద్ జిల్లాలో ఎరువుల సంక్షోభం: రైతులకు దెబ్బ|Fertilizer Crisis Hits Mahabubabad Farmers|@6TV మహబూబాబాద్ జిల్లాలో ఎరువుల సంక్షోభం: రైతులకు దెబ్బ|Fertilizer Crisis Hits Mahabubabad Farmers| ⁨@6TV⁩ ​ #Mahabubabad #FertilizerCrisis #FarmersIssues #TelanganaNews #UreaShortage #AgricultureCrisis #FarmingProblems #SupportFarmers #6tv #telugunews #breakingnews #newslive #apnews #telanganalatestnews #telangana #andhrapradesh #appolitics Stay Informed with 6tv Telugu News Live Whether you are a resident of Telugu-speaking regions or simply have an interest in Telugu news and culture, 6tv Telugu News Live is the perfect source of information for you. Stay informed, stay engaged, and stay connected with 6tv Telugu News Live. Tune in today and experience the difference that quality news coverage can make in your life. In conclusion, 6tv Telugu News Live is your go-to source for all things Telugu news. With live coverage, expert analysis, and unbiased reporting, 6tv Telugu News Live ensures that you stay informed and up-to-date on the latest happenings. Don't miss out on important news updates - tune in to 6tv Telugu News Live today! ► Subscribe to 6TV : https://www.youtube.com/@6TV ► Subscribe to 6TV Digital: : https://www.youtube.com/@6TVDigital ► Subscribe to 6TV Telugu : https://www.youtube.com//@6TVTeluguNews ► Like us on Facebook : https://www.facebook.com/6tv ► Follow us on Instagram : https://www.instagram.com/6tvnews ► Follow us on Twitter : https://twitter.com/6tv_telugu ► Visit Website : https://6tvnews.com/

English · AI translation

Fertilizer crisis in Mahabubabad district: a blow to farmers | Fertilizer Crisis Hits Mahabubabad Farmers | @6TV Fertilizer crisis in Mahabubabad district: a blow to farmers | @6TV Stay Informed with 6tv Telugu News Live Whether you are a resident of Telugu-speaking regions or simply have an interest in Telugu news and culture, 6tv Telugu News Live is the perfect source of information for you. Stay informed, stay engaged, and stay connected with 6tv Telugu News Live. Tune in today and experience the difference that quality news coverage can make in your life. In conclusion, 6tv Telugu News Live is your go-to source for all things Telugu news. With live coverage, expert analysis, and unbiased reporting, 6tv Telugu News Live ensures that you stay informed and up-to-date on the latest happenings. Don't miss out on important news updates - tune in to 6tv Telugu News Live today!

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer crisis in Mahabubabad district.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 96%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2773ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention ad2cc3f7 · raw item d80e3914 · origin live

YouTubeQv9 newsMedia organisation92%19 Aug, 11:18 IST
Karimnagar (98% conf.)Telugustance: critical198 views · 5 likes · 0 comments

సకాలంలో ఎరువులు రైతులకు అందాలని కరీంనగర్ హైవే రోడ్డు పై బీఆర్ఎస్ శ్రేణులు ధర్నా

Original — Telugu

సకాలంలో ఎరువులు రైతులకు అందాలని కరీంనగర్ హైవే రోడ్డు పై బీఆర్ఎస్ శ్రేణులు ధర్నా

English · AI translation

BRS workers staged a dharna on the Karimnagar highway road demanding that fertilizers be supplied to farmers on time. BRS workers staged a dharna on the Karimnagar highway road demanding that fertilizers be supplied to farmers on time.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“BRS workers staged a dharna on the Karimnagar highway road demanding timely fertilizer supply to farmers.” · confidence 98%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2229ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:37
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 1c52da94 · raw item 309c4f18 · origin live

YouTubeTelugu Health GuruMedia organisation84%17 Aug, 20:39 IST
Rajanna Sircilla · vemulawada rural (98% conf.)Telugustance: neutral13 views · 0 likes · 0 comments

ఎరువుల దుకాణాన్ని ప్రారంభించిన ఎమ్మెల్యే, కలెక్టర్ | Rajanna Sircilla | Way2news Telugu

Original — Telugu

Rajanna Sircilla వార్తల కోసం Download వే2న్యూస్ App వేములవాడ రూరల్ మండలం బొల్లారం గ్రామంలో శివరాం గ్రామ మహిళా సమైక్య సంఘం ఎరువుల దుకాణాన్ని స్థానిక ఎమ్మెల్యే ఆది శ్రీనివాస్, కలెక్టర్ సందీప్ కుమార్ ఝా శనివారం ప్రారంభించారు. రైతులందరూ వచ్చి గ్రామ మహిళా సమైక్య సంఘంలో ఎరువులు కొనుగోలు చేసి అతివల అభివృద్ధికి సహకరించాలని వారు కోరారు. మహిళా సాధికారతకు ప్రభుత్వం అనేక అభివృద్ధి, సంక్షేమ పథకాలను తీసుకువస్తుందని MLA అన్నారు.

Show full source text as published

ఎరువుల దుకాణాన్ని ప్రారంభించిన ఎమ్మెల్యే, కలెక్టర్ | Rajanna Sircilla | Way2news Telugu Rajanna Sircilla వార్తల కోసం Download వే2న్యూస్ App వేములవాడ రూరల్ మండలం బొల్లారం గ్రామంలో శివరాం గ్రామ మహిళా సమైక్య సంఘం ఎరువుల దుకాణాన్ని స్థానిక ఎమ్మెల్యే ఆది శ్రీనివాస్, కలెక్టర్ సందీప్ కుమార్ ఝా శనివారం ప్రారంభించారు. రైతులందరూ వచ్చి గ్రామ మహిళా సమైక్య సంఘంలో ఎరువులు కొనుగోలు చేసి అతివల అభివృద్ధికి సహకరించాలని వారు కోరారు. మహిళా సాధికారతకు ప్రభుత్వం అనేక అభివృద్ధి, సంక్షేమ పథకాలను తీసుకువస్తుందని MLA అన్నారు. #vemulawadaruralmandal #grammahilasamaikyasangam #sivaram #mahila #collectorsandeepkumarjha #welfareschemes #saturday #manydevelopment #bollaramvillageofvemulawadaruralmandal #mlaadisrinivas #samaikya #sandeep #collector #kumarjha #mla #bollaram #sivaramgrammahilasamaikyasangamfertilizershop #womenempowerment #ativala #gram #adisrinivas #sangam #way2news #way2newstelugu

English · AI translation

MLA and Collector inaugurated a fertilizer shop | Rajanna Sircilla | Way2news Telugu For Rajanna Sircilla news, download the Way2News app. In Bollaram village of Vemulawada Rural mandal, the local MLA Adi Srinivas and Collector Sandeep Kumar Jha on Saturday inaugurated a fertilizer shop of the Shiva Ram Gram Mahila Samakhya Sangham. They requested all farmers to come and buy fertilizers from the village women’s federation and support the development of women. The MLA said that the government is bringing many development and welfare schemes for women’s empowerment.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The MLA and Collector inaugurated a fertilizer shop run by the Shiva Ram Gram Mahila Samakhya Sangham in Bollaram village, Vemulawada Rural mandal, Rajanna Sircilla district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2829ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 67381541 · raw item ae279da8 · origin live

YouTubeSSC KARIMNAGAR NEWSMedia organisation90%14 Aug, 19:03 IST
Karimnagar (96% conf.)Telugustance: neutral53 views · 0 likes · 0 comments

మహిళా సంఘం ఎరువులు & విత్తనాల దుకాణం ప్రారంభం||SSC NEWS KARIMNAGAR || 14-08-2025||

Original — Telugu

#SSC #KARIMNAGAR #NEWS #నిజం...మా నైజం...

English · AI translation

Women’s group fertilizer and seeds shop inaugurated || SSC NEWS KARIMNAGAR || 14-08-2025 || #SSC #KARIMNAGAR #NEWS #Truth...our nature...

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A women’s group fertilizer and seeds shop was started.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1801ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:37
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention b43978e3 · raw item 61a76f41 · origin live

YouTubeinews teluguMedia organisation97%9 Aug, 12:09 IST
Rajanna Sircilla (99% conf.)Telugustance: neutral334 views · 1 likes · 0 comments

రాజన్న సిరిసిల్ల జిల్లాలో రైతులకు ఎరువు కష్టాలు | Farmers Facing Difficulties In Getting Fertilizers

Original — Telugu

రాజన్న సిరిసిల్ల జిల్లాలో రైతులకు ఎరువు కష్టాలు | Farmers Facing Difficulties In Getting Fertilizers | iNews

Show full source text as published

రాజన్న సిరిసిల్ల జిల్లాలో రైతులకు ఎరువు కష్టాలు | Farmers Facing Difficulties In Getting Fertilizers #rajannasirisilla #telangana #inews రాజన్న సిరిసిల్ల జిల్లాలో రైతులకు ఎరువు కష్టాలు | Farmers Facing Difficulties In Getting Fertilizers | iNews Follow Us On 👍Facebook : https://www.facebook.com/INews 📷INSTAGRAM : https://www.instagram.com/inewsofficial 🐦Twitter (X) : https://x.com/inewstelugu 📱Whatsapp : https://shorturl.at/BcUNu Also Watch i Special : https://shorturl.at/HXOe0 I Focus : https://shorturl.at/S6fmT Loguttu : https://shorturl.at/AHZIO Idhi Nijam : https://shorturl.at/s2qcM Subscribe More iNews AP : https://www.youtube.com/@iNewsAP iNews ENT : https://www.youtube.com/@inewsentertainment iNews TS : https://www.youtube.com/@inewsTS Welcome To INews iNews Is One Of The Leading Satellite News Channel Owned By Udbhav Media Private Limited. iNews Dedicated To Delivering Timely, Truthful, And Powerful News Content To The Telugu-Speaking Population Across Andhra Pradesh And Telangana. As A Trusted Name In Regional Journalism, Our Mission Is To Inform, Engage, And Empower Viewers Through High-Quality Reporting And Unbiased Coverage. At iNews Telugu, We Believe In The Power Of Journalism To Shape Society. Our Content Spans Across A Wide Spectrum Of Categories – From Real-Time Breaking News And In-Depth Political Analysis To Entertainment Updates, Social Issues, And Inspiring Human-Interest Stories. Whether It's A Major Political Development, A Local Civic Issue, Or A National Event That Impacts Telugu People, We Bring It To You With Clarity And Integrity. We Operate 24/7 With A Dynamic Team Of Experienced Journalists, Field Reporters, Anchors, And Editors Who Work Relentlessly To Keep You Informed. Every Report We Publish Is Guided By Our Core Values – Accuracy, Responsibility, Transparency, And Public Service. Our Commitment Is To Represent The Voice Of Every Common Citizen, Highlight Grassroots Realities, And Serve As A Reliable Platform For Dialogue And Awareness. iNews Exclusively Delivering Programs Like In Depth, I Focus, I Special, Idhi Nijam And Loguttu, These Programs Are Attracting Audience More. Now These Programs Placed Most Viewed Programs Across The Telugu States. As A Digital-First News Channel, Our YouTube Presence Is Designed To Ensure That Telugu News Is Accessible To Everyone, Anytime, Anywhere. We Provide Daily Video Updates, Live News Coverage, Special Programs, Expert Interviews, Public Debates, And Ground Reports That Give Deeper Context To The Headlines. By Subscribing To iNews, You Become Part Of A Movement For Informed Citizenship. We Invite You To Watch, Comment, Share, And Stay Connected With Us – Because Your Voice Matters, And Every Story Counts. Subscribe To INews Telugu. Stay Alert. Stay Aware. Stay Ahead. Disclaimer: iNews may provide content through third-party websites, operating systems, platforms, and portals (‘Third-Party Platforms’). iNews does not control and has no liability for Third-Party Platforms, including content hosted, advertisements, security, functionality, operation, or availability. #iNews #iNewsTelugu #iNewsLatest ► Like us on Facebook :https://www.facebook.com/INews ► Follow us on Instagram : https://www.instagram.com/inewsofficial ► Follow us on Twitter : https://twitter.com/inewstelugu ► Follow us on Official Site : https://inewstelugu.com/ #StockMarket #VenkatMeka #StockMarketForBeginners

English · AI translation

Farmers are facing fertilizer difficulties in Rajanna Sircilla district. | Farmers Facing Difficulties In Getting Fertilizers | iNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Rajanna Sircilla district are facing difficulties in getting fertilizers.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1416ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 7077376c · raw item 3ee99215 · origin live

YouTubeRTV MahabubnagarMedia organisation98%5 Aug, 14:14 IST
Mahabubnagar (98% conf.)Telugu / Englishstance: neutral4,477 views · 108 likes · 10 comments

Organic Fertilizer Manufacturing | మహబూబ్ నగర్ జిల్లాలో వినూత్న రీతిలో సేంద్రియ ఎరువుల తయారీ | RTV

Original — Telugu / English

Organic Fertilizer Manufacturing | మహబూబ్ నగర్ జిల్లాలో వినూత్న రీతిలో సేంద్రియ ఎరువుల తయారీ | RTV

Show full source text as published

Organic Fertilizer Manufacturing | మహబూబ్ నగర్ జిల్లాలో వినూత్న రీతిలో సేంద్రియ ఎరువుల తయారీ | RTV Organic Fertilizer Manufacturing | మహబూబ్ నగర్ జిల్లాలో వినూత్న రీతిలో సేంద్రియ ఎరువుల తయారీ | RTV #fertilizer #manufacturing #rtvmahabubnagar ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Organic Fertilizer Manufacturing | Innovative organic fertilizer manufacturing in Mahabubnagar district | RTV

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Organic fertilizer manufacturing is being done in Mahabubnagar district in an innovative way.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1762ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:30
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:34
  4. DEDUPED · 10 Sept, 15:37
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 3be07b22 · raw item 3ba9d069 · origin live

YouTubeAndhra UncutMedia organisation90%31 Jul, 19:12 IST
Nizamabad · mopal (98% conf.)Telugustance: neutral1,004 views · 2 likes · 0 comments

మోపాల్: ఎరువుల గోడౌన్‌ను తనిఖీ చేసిన కలెక్టర్ | Nizamabad | Way2news Telugu

Original — Telugu

Nizamabad వార్తల కోసం Download వే2న్యూస్ App మోపాల్‌లోని సహకార సంఘం ఎరువుల గోడౌన్‌ను కలెక్టర్ టి.వినయ్ కృష్ణా రెడ్డి గురువారం ఆకస్మికంగా తనిఖీ చేశారు. గిడ్డంగిలో రికార్డుల్లో పేర్కొన్న విధంగా ఎరువుల నిల్వలు అందుబాటులో ఉన్నాయా లేదా అని పరిశీలించారు. ఈ-పాస్ ద్వారా నిర్వహిస్తున్నారా లేదా అని ఆరా తీశారు. స్టాక్ కొంత మిగిలి ఉన్నప్పుడే ఇండెంట్ సమర్పించి, ఎరువులను గోడౌన్‌కు తెప్పించుకోవాలని నిర్వాహకులకు సూచించారు.

Show full source text as published

మోపాల్: ఎరువుల గోడౌన్‌ను తనిఖీ చేసిన కలెక్టర్ | Nizamabad | Way2news Telugu Nizamabad వార్తల కోసం Download వే2న్యూస్ App మోపాల్‌లోని సహకార సంఘం ఎరువుల గోడౌన్‌ను కలెక్టర్ టి.వినయ్ కృష్ణా రెడ్డి గురువారం ఆకస్మికంగా తనిఖీ చేశారు. గిడ్డంగిలో రికార్డుల్లో పేర్కొన్న విధంగా ఎరువుల నిల్వలు అందుబాటులో ఉన్నాయా లేదా అని పరిశీలించారు. ఈ-పాస్ ద్వారా నిర్వహిస్తున్నారా లేదా అని ఆరా తీశారు. స్టాక్ కొంత మిగిలి ఉన్నప్పుడే ఇండెంట్ సమర్పించి, ఎరువులను గోడౌన్‌కు తెప్పించుకోవాలని నిర్వాహకులకు సూచించారు. #fertilizerstocks #cooperativefertilizergodown #collector #thursday #mopal #vinaykrishnareddy #surpriseinspection #epass #way2news #way2newstelugu

English · AI translation

Collector T. Vinay Krishna Reddy conducted a surprise inspection of the cooperative society fertilizer godown in Mopal on Thursday. He checked whether fertilizer stocks were available in the warehouse as per the records and asked whether it was being managed through e-pass. He instructed the managers to submit the indent while some stock was still left and get the fertilizers brought to the godown.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The collector conducted a surprise inspection of the cooperative society fertilizer godown in Mopal and checked whether fertilizer stocks and e-pass handling matched records.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2055ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 30f8d519 · raw item d25100a9 · origin live

YouTubeB5NEWSMedia organisation98%30 Jul, 19:51 IST
Jangaon · station-ghanpur (98% conf.)Telugustance: neutral111 views · 2 likes · 0 comments

జనగామ జిల్లా స్టేషన్ ఘన్పూర్ లో ఎరువుల దుకాణాలు తనిఖీ చేసిన జిల్లా కలెక్టర్

Original — Telugu

జనగామ జిల్లా స్టేషన్ ఘన్పూర్ లో ఎరువుల దుకాణాలు తనిఖీ చేసిన జిల్లా కలెక్టర్

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“The district collector inspected fertilizer shops in Station Ghanpur, Jangaon district.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1962ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 3c13a2ab · raw item 3b0c91c9 · origin live

YouTubeRTV KarimnagarMedia organisation98%28 Jul, 14:01 IST
Karimnagar (83% conf.)Telugu / Englishstance: critical124 views · 1 likes · 0 comments

Minister Ponnam Prabhakar Comments | ఎరువులు పంపిణీలో తెలంగాణకు కేంద్రం అన్యాయం | RTV Karimnagar

Original — Telugu / English

Minister Ponnam Prabhakar Comments | ఎరువులు పంపిణీలో తెలంగాణకు కేంద్రం అన్యాయం | RTV Karimnagar

Show full source text as published

Minister Ponnam Prabhakar Comments | ఎరువులు పంపిణీలో తెలంగాణకు కేంద్రం అన్యాయం | RTV Karimnagar Minister Ponnam Prabhakar Comments | ఎరువులు పంపిణీలో తెలంగాణకు కేంద్రం అన్యాయం | RTV Karimnagar #ministerponnamprabhakar #rtvkarimnagar ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Minister Ponnam Prabhakar Comments | Telangana is being treated unfairly by the Centre in fertilizer distribution | RTV Karimnagar

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The central government has treated Telangana unfairly in fertilizer distribution.” · confidence 86%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 80%Classification confidence: 79%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1782ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:37
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 4ceba2cd · raw item 00b695d2 · origin live

YouTubeMahaa NewsMedia organisation99%26 Jul, 16:41 IST
Nizamabad (98% conf.)Telugustance: neutral1,466 views · 6 likes · 0 comments

నిజామాబాద్ జిల్లాలో కలెక్టర్ ఎరువుల గోడౌన్లను తనిఖీ | Nizamabad District | Fertilizer | Mahaa News

Original — Telugu

Watch : Mahaa News Live is a 24-hour Telugu News Channel Covering Mainly News & Events In Andhra Pradesh & Telangana. Tune In For Current Political, Sports, Health, Crime, Business, Entertainment & Weather Reports. Watch Live Debates, Exclusive Live Interviews With People Who Matter. Stay Updated With Mahaa News Live on YouTube For All The Latest News From India and Across The World. For More Latest Updates On The News: • Video

Show full source text as published

నిజామాబాద్ జిల్లాలో కలెక్టర్ ఎరువుల గోడౌన్లను తనిఖీ | Nizamabad District | Fertilizer | Mahaa News #nizamabadupdates #nizamabaddistrict #fertilizers #telangananews #today_breaking_news #viralnews #viralshorts #mahaanews #mahaanewslive #mahaatelugunews నిజామాబాద్ జిల్లాలో కలెక్టర్ ఎరువుల గోడౌన్లను తనిఖీ | Nizamabad District | Fertilizer | Mahaa News “Thanks for watching. If you liked this video, make sure to subscribe for more!” Watch : Mahaa News Live is a 24-hour Telugu News Channel Covering Mainly News & Events In Andhra Pradesh & Telangana. Tune In For Current Political, Sports, Health, Crime, Business, Entertainment & Weather Reports. Watch Live Debates, Exclusive Live Interviews With People Who Matter. Stay Updated With Mahaa News Live on YouTube For All The Latest News From India and Across The World. For More Latest Updates On The News: • Video Subscribe to Mahaa News : https://www.youtube.com/@mahaanews/featured Subscribe to Mahaa Telangana : https://www.youtube.com/@MahaaTelangana/videos Subscribe to Mahaa Max : https://www.youtube.com/@MahaaMax Subscribe to Mahaa Vamsi : https://www.youtube.com/channel/UCf40zfa4GGOC9s8yoQhGZGg Subscribe to Mahaa Entertainment : https://www.youtube.com/@MAHAAEntertainment Subscribe to Mahaa Debates : https://www.youtube.com/@MahaaDebates Subscribe to The Leader With Vamsi : https://www.youtube.com/@TheLeaderWithVamsi Subscribe to Mahaa USA :https://www.youtube.com/@mahatvusa Subscribe to Mahaa Shorts : https://www.youtube.com/@mahaashort/shorts Please,Like,Share And Subscrbe To Our Youtube Channel And Also Follow Us On : Facebook : https://www.facebook.com/Mahaanews/ Instagram : https://www.instagram.com/mahaanews/ Twitter : https://x.com/MahaaOfficial Website : https://mahaanews.co.in/ Subscrbe For Updates : https://www.youtube.com/@mahaanews/featured

English · AI translation

The collector inspected fertilizer godowns in Nizamabad district | Nizamabad District | Fertilizer | Mahaa News Watch: Mahaa News Live is a 24-hour Telugu news channel covering mainly news and events in Andhra Pradesh and Telangana. Tune in for current political, sports, health, crime, business, entertainment and weather reports. Watch live debates, exclusive live interviews with people who matter. Stay updated with Mahaa News Live on YouTube for all the latest news from India and across the world. For more latest updates on the news: • Video

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The collector inspected fertilizer godowns in Nizamabad district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2775ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 941dc529 · raw item 5a9d1e75 · origin live

YouTubeRTV AdilabadMedia organisation96%25 Jul, 12:37 IST
Nirmal (98% conf.)Telugu / Englishstance: neutral211 views · 0 likes · 0 comments

Collector Abhilasha Abhinav Inspects Fertilizer Shop At Nirmal | RTV Adilabad

Original — Telugu / English

నిర్మల్ లో ఫర్టిలైజర్ షాపులను తనిఖీ చేసిన కలెక్టర్ | Collector Abhilasha Abhinav Inspects Fertilizer Shop At Nirmal | RTV Adilabad

Show full source text as published

Collector Abhilasha Abhinav Inspects Fertilizer Shop At Nirmal | RTV Adilabad నిర్మల్ లో ఫర్టిలైజర్ షాపులను తనిఖీ చేసిన కలెక్టర్ | Collector Abhilasha Abhinav Inspects Fertilizer Shop At Nirmal | RTV Adilabad #collectorabhilashaabhinav #fertilizers #rtvadilabad ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Collector Abhilasha Abhinav inspected fertilizer shops in Nirmal.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Collector Abhilasha Abhinav inspected fertilizer shops in Nirmal.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1509ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:27
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention b633f3f1 · raw item c47f777a · origin live

YouTubeANN OriginalsMedia organisation93%24 Jul, 20:48 IST
Mancherial · jannaram (93% conf.)Telugu / Englishstance: neutral726 views · 1 likes · 0 comments

ADILABAD : జన్నారంలో పోలీసుల ఎరువుల దుకాణాలలో త‌నిఖీలు | Inspection In Fertilizer Stores In Jannaram

Original — Telugu / English

ANN Telugu LIVE🔴: Telugu News Live Updates | ANN Telugu For more latest updates on the news : ► FacebookGroup :

Show full source text as published

ADILABAD : జన్నారంలో పోలీసుల ఎరువుల దుకాణాలలో త‌నిఖీలు | Inspection In Fertilizer Stores In Jannaram #anntelugu #annnlivetelugu #annlivenews #anntelugulive ADILABAD : జన్నారంలో పోలీసుల ఎరువుల దుకాణాలలో త‌నిఖీలు | Inspection In Fertilizer Stores In Jannaram ANN Telugu LIVE🔴: Telugu News Live Updates | ANN Telugu You are Watching AmmaNews Live. It is a leading Telugu News Channel, bringing you the first account of all the latest news online from around the world including breaking news, regional news, national news, international news, sports updates, entertainment gossips, political news, crime reports. If you like this video, please don’t forget to subscribe and like, commnet the AmmaNews Live for more interesting updates and Trending Public videos. For more latest updates on the news : ► Subscribe to Amma News Channel: https://www.youtube.com/c/Ammanewslivev ► Like us on Facebook: https: https://www.facebook.com/Ammanewslive/ ► Follow us on Twitter : https://twitter.com/ammanews1 ► ShareChat : https://sharechat.com/profile/ammanewslive?referrer=copyLink ► FacebookGroup : https://www.facebook.com/groups/1813851678807723 ► Instagram : https://instagram.com/ammanewslive11?utm_medium=copy_link ► Koo APP https://www.kooapp.com/profile/AmmaNewsLive

English · AI translation

ADILABAD: Police inspections at fertilizer shops in Jannaram | Inspection in fertilizer stores in Jannaram ANN Telugu LIVE🔴: Telugu News Live Updates | ANN Telugu For more latest updates on the news: ► FacebookGroup :

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Police inspected fertilizer shops in Jannaram in Adilabad.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1523ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:24
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 21881a15 · raw item 35b7d4ad · origin live

YouTubeDivya KheshtramMedia organisation92%23 Jul, 21:16 IST
Nirmal (99% conf.)Telugustance: neutral1,238 views · 5 likes · 0 comments

నిర్మల్: ఎరువుల దుకాణాల తనిఖీ | Nirmal | Way2news Telugu

Original — Telugu

Nirmal వార్తల కోసం Download వే2న్యూస్ App నిర్మల్ జిల్లాలో రైతులకు ఎరువుల కొరత లేకుండా చూడాలని కలెక్టర్ అభిలాష అభినవ్ అధికారులను ఆదేశించారు. బుధవారం నిర్మల్ మినీ ట్యాంక్‌బండ్ సమీపంలోని గాయత్రి ఫర్టిలైజర్‌తో పాటు కొండాపూర్‌లోని శ్రీసాయి ఎరువుల దుకాణాలను కలెక్టర్ ఆకస్మికంగా తనిఖీ చేశారు. ఈ సందర్భంగా విత్తనాలు, ఎరువులు, పురుగుమందుల ప్యాకింగ్ లేబుళ్లు, గడువు తేదీలు, రిజిస్టర్లను పరిశీలించారు.

Show full source text as published

నిర్మల్: ఎరువుల దుకాణాల తనిఖీ | Nirmal | Way2news Telugu Nirmal వార్తల కోసం Download వే2న్యూస్ App నిర్మల్ జిల్లాలో రైతులకు ఎరువుల కొరత లేకుండా చూడాలని కలెక్టర్ అభిలాష అభినవ్ అధికారులను ఆదేశించారు. బుధవారం నిర్మల్ మినీ ట్యాంక్‌బండ్ సమీపంలోని గాయత్రి ఫర్టిలైజర్‌తో పాటు కొండాపూర్‌లోని శ్రీసాయి ఎరువుల దుకాణాలను కలెక్టర్ ఆకస్మికంగా తనిఖీ చేశారు. ఈ సందర్భంగా విత్తనాలు, ఎరువులు, పురుగుమందుల ప్యాకింగ్ లేబుళ్లు, గడువు తేదీలు, రిజిస్టర్లను పరిశీలించారు. #expirydates #kondapur #nirmal #expiry #abhilashaabhinav #packinglabels #srisaifertilizershops #srisaifertilizer #collector #nirmaldistrict #wednesday #gayatrifertilizer #mini #abhilashaabhinav #tank #surpriseinspection #nirmalminitankbund #way2news #way2newstelugu

English · AI translation

Nirmal: Inspection of fertilizer shops | Nirmal | Way2news Telugu For Nirmal news, download the Way2News app Collector Abhilash Abhinav instructed officials to ensure that farmers in Nirmal district do not face a shortage of fertilizers. On Wednesday, the collector conducted a surprise inspection of Gayatri Fertilizers near Nirmal Mini Tank Bund and Sri Sai fertilizer shop in Kondapur. On this occasion, he examined the packaging labels, expiry dates, and registers of seeds, fertilizers, and pesticides.

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The collector inspected fertilizer shops in Nirmal district and checked labels, expiry dates, and registers for seeds, fertilizers, and pesticides.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3727ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 96fa595d · raw item 4737f5c9 · origin live

YouTubeS6 News WarangalMedia organisation95%22 Jul, 18:40 IST
Warangal (92% conf.)Telugustance: critical28 views · 1 likes · 0 comments

ఎరువుల కోసం రైతుల పడిగాపులు! | 🚨 Ex-MLA Gandra Slams Congress Govt | S6 News Warangal

Original — Telugu

ఎరువుల కోసం రైతుల పడిగాపులు! | 🚨 Ex-MLA Gandra Slams Congress Govt | S6 News Warangal

Show full source text as published

ఎరువుల కోసం రైతుల పడిగాపులు! | 🚨 Ex-MLA Gandra Slams Congress Govt | S6 News Warangal ఎరువుల కోసం రైతుల పడిగాపులు! | 🚨 Ex-MLA Gandra Slams Congress Govt | S6 News Warangal #GandraVenkataRamana #CongressGovernment #FertilizerShortage #FarmersProblems #JayashankarBhupalpally #SridharBabu #WarangalDistrict #PoliticalNews #TelanganaNews 📍 Jayashankar Bhupalpally District – a key farming zone in former Warangal district, now facing fertilizer crisis under the Congress government. 🗣️ Ex-MLA Gandra Venkata Ramana Reddy Fires On Govt: 👞 “Farmers are forced to line up their slippers to wait for fertilizers... This is the sad state after Congress came to power!” 📢 Gandra urged Minister Sridhar Babu to ensure there’s no shortage of fertilizers in major farming districts like Bhupalpally. ⚠️ Farmers demand immediate action as agriculture operations are getting delayed. 🎥 Watch Full Press Meet Coverage! 📡 Real voices from the field 🧑‍🌾 Ground reality of farmers 🛑 Political counter-attacks begin! 👍 Like | 🔁 Share | 🔔 Subscribe for more Real-Time Political Updates from S6 News Warangal

English · AI translation

Farmers are waiting for fertilizers! | 🚨 Ex-MLA Gandra slams Congress government | S6 News Warangal

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are waiting for fertilizers.” · confidence 90%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1425ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:29
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f524795a · raw item 9513be69 · origin live

YouTubeANN OriginalsMedia organisation93%16 Jul, 20:04 IST
Adilabad (97% conf.)Telugu / Englishstance: neutral13 views · 0 likes · 0 comments

Adilabad : శ్రీ సాయి ఫర్టిలైజర్స్ షాప్ లో దొంగతనం | Robbery In Fertilizers Shop | ANN LIve

Original — Telugu / English

Adilabadad : శ్రీ సాయి ఫర్టిలైజర్స్ షాప్ లో దొంగతనం | Robbery In Fertilizers Shop | ANN LIve ANN Telugu LIVE🔴: Telugu News Live Updates | ANN Telugu For more latest updates on the news : ► FacebookGroup :

Show full source text as published

Adilabad : శ్రీ సాయి ఫర్టిలైజర్స్ షాప్ లో దొంగతనం | Robbery In Fertilizers Shop | ANN LIve #adilabadnews #robbery #anntelugu Adilabadad : శ్రీ సాయి ఫర్టిలైజర్స్ షాప్ లో దొంగతనం | Robbery In Fertilizers Shop | ANN LIve ANN Telugu LIVE🔴: Telugu News Live Updates | ANN Telugu You are Watching AmmaNews Live. It is a leading Telugu News Channel, bringing you the first account of all the latest news online from around the world including breaking news, regional news, national news, international news, sports updates, entertainment gossips, political news, crime reports. If you like this video, please don’t forget to subscribe and like, commnet the AmmaNews Live for more interesting updates and Trending Public videos. For more latest updates on the news : ► Subscribe to Amma News Channel: https://www.youtube.com/c/Ammanewslivev ► Like us on Facebook: https: https://www.facebook.com/Ammanewslive/ ► Follow us on Twitter : https://twitter.com/ammanews1 ► ShareChat : https://sharechat.com/profile/ammanewslive?referrer=copyLink ► FacebookGroup : https://www.facebook.com/groups/1813851678807723 ► Instagram : https://instagram.com/ammanewslive11?utm_medium=copy_link ► Koo APP https://www.kooapp.com/profile/AmmaNewsLive

English · AI translation

Adilabad: Theft at Shri Sai Fertilizers shop | Robbery in Fertilizers Shop | ANN Live Adilabad: Theft at Shri Sai Fertilizers shop | Robbery in Fertilizers Shop | ANN Live ANN Telugu LIVE🔴: Telugu News Live Updates | ANN Telugu For more latest updates on the news: ► FacebookGroup :

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A robbery occurred at Shri Sai Fertilizers shop in Adilabad.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 72%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4621ms)

Processing trail
  1. NORMALIZED · 9 Sept, 18:22
  2. RELEVANCE_ACCEPTED · 9 Sept, 18:22
  3. ENRICHED · 9 Sept, 18:27
  4. DEDUPED · 9 Sept, 18:27
  5. NARRATIVE_ASSIGNED · 9 Sept, 18:27
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention ae6d8fb4 · raw item 7bb9be3c · origin live

YouTubeRaj News TeluguMedia organisation98%16 Jul, 13:58 IST
Hanumakonda (98% conf.)Telugu / Englishstance: neutral345 views · 0 likes · 0 comments
Was live

ఎరువుల కోసం హనుమకొండలో అన్నదాతల క్యూలైన్| Farmers Struggling For Fertilizers in Hanumakonda| RajNews

Original — Telugu / English

ఎరువుల కోసం హనుమకొండ లో అన్నదాతల క్యూలైన్ | Farmers Struggling For Fertilizers in Hanumakonda | Raj News "RAJ NEWS న్యూస్ తెలుగు" - తెలంగాణ & ఆంధ్రప్రదేశ్ కోసం అన్ని రకాల వార్తలు అనేది తెలంగాణ మరియు ఆంధ్రప్రదేశ్ రాష్ట్రాల నుండి సమగ్రమైన మరియు తాజా వార్తల కవరేజీని అందించడానికి అంకితమైన డైనమిక్ తెలుగు న్యూస్ ఛానెల్. రాజకీయాలు, కరెంట్ అఫైర్స్, బిజినెస్, స్పోర్ట్స్, ఎంటర్‌టైన్‌మెంట్, టెక్నాలజీ, ఆరోగ్యం మరియు మరిన్నింటితో సహా విస్తృత శ్రేణి అంశాలపై సమాచారాన్ని కోరుకునే వీక్షకులకు మా తెలుగు న్యూస్ ఛానెల్ వన్-స్టాప్ గమ్యస్థానాన్ని అందిస్తుంది. అంకితమైన జర్నలిస్టులు మరియు రిపోర్టర్‌ల బృందంతో, మేము మా ప్రేక్షకులకు తాజా పరిణామాలు, బ్రేకింగ్ న్యూస్, ప్రత్యేక ఇంటర్వ్యూలు మరియు రెండు రాష్ట్రాలను ప్రభావితం చేసే సమస్యల యొక్క లోతైన విశ్లేషణను అందించడానికి ప్రయత్నిస్తున్నాము. మీరు తెలంగాణా లేదా ఆంధ్ర ప్రదేశ్ నివాసి అయినా, తెలుగు ప్రవాసుల సభ్యుడైనా లేదా ఈ ప్రాంతాలలో జరుగుతున్న సంఘటనలను తెలుసుకోవాలనే ఆసక్తి ఉన్నవారైనా, Raj News కవర్ చేస్తుంది. మేము మా వీక్షకులకు ఖచ్చితమైన, నిష్పాక్షికమైన మరియు సమయానుకూలమైన వార్తల కవరేజీతో సాధికారత కల్పించాలని లక్ష్యంగా పెట్టుకున్నాము, వారికి సమాచారంతో కూడిన నిర్ణయాలు తీసుకోవడంలో మరియు వారి కమ్యూనిటీలతో కనెక్ట్ అయి ఉండటంలో వారికి సహాయం చేస్తుంది. తెలంగాణ మరియు ఆంధ్రప్రదేశ్ నుండి అన్ని వార్తలు మరియు అప్‌డేట్‌లను మీకు తెలియజేయడానికి మరియు నిమగ్నమై ఉండటానికి మా ప్రయాణంలో మాతో చేరండి. ఈరోజే Raj News వార్తలకు సబ్‌స్క్రయిబ్ చేసుకోండి మరియు మా విశ్వసనీయమైన మరియు సమగ్రమైన వార్తల కవరేజీలో ముందుండి. "Raj News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, Raj News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities.

Show full source text as published

ఎరువుల కోసం హనుమకొండలో అన్నదాతల క్యూలైన్| Farmers Struggling For Fertilizers in Hanumakonda| RajNews ఎరువుల కోసం హనుమకొండ లో అన్నదాతల క్యూలైన్ | Farmers Struggling For Fertilizers in Hanumakonda | Raj News #hanumakonda #telangananews #ureafertilizer #brekingnews #rajnewstelugu "RAJ NEWS న్యూస్ తెలుగు" - తెలంగాణ & ఆంధ్రప్రదేశ్ కోసం అన్ని రకాల వార్తలు అనేది తెలంగాణ మరియు ఆంధ్రప్రదేశ్ రాష్ట్రాల నుండి సమగ్రమైన మరియు తాజా వార్తల కవరేజీని అందించడానికి అంకితమైన డైనమిక్ తెలుగు న్యూస్ ఛానెల్. రాజకీయాలు, కరెంట్ అఫైర్స్, బిజినెస్, స్పోర్ట్స్, ఎంటర్‌టైన్‌మెంట్, టెక్నాలజీ, ఆరోగ్యం మరియు మరిన్నింటితో సహా విస్తృత శ్రేణి అంశాలపై సమాచారాన్ని కోరుకునే వీక్షకులకు మా తెలుగు న్యూస్ ఛానెల్ వన్-స్టాప్ గమ్యస్థానాన్ని అందిస్తుంది. అంకితమైన జర్నలిస్టులు మరియు రిపోర్టర్‌ల బృందంతో, మేము మా ప్రేక్షకులకు తాజా పరిణామాలు, బ్రేకింగ్ న్యూస్, ప్రత్యేక ఇంటర్వ్యూలు మరియు రెండు రాష్ట్రాలను ప్రభావితం చేసే సమస్యల యొక్క లోతైన విశ్లేషణను అందించడానికి ప్రయత్నిస్తున్నాము. మీరు తెలంగాణా లేదా ఆంధ్ర ప్రదేశ్ నివాసి అయినా, తెలుగు ప్రవాసుల సభ్యుడైనా లేదా ఈ ప్రాంతాలలో జరుగుతున్న సంఘటనలను తెలుసుకోవాలనే ఆసక్తి ఉన్నవారైనా, Raj News కవర్ చేస్తుంది. మేము మా వీక్షకులకు ఖచ్చితమైన, నిష్పాక్షికమైన మరియు సమయానుకూలమైన వార్తల కవరేజీతో సాధికారత కల్పించాలని లక్ష్యంగా పెట్టుకున్నాము, వారికి సమాచారంతో కూడిన నిర్ణయాలు తీసుకోవడంలో మరియు వారి కమ్యూనిటీలతో కనెక్ట్ అయి ఉండటంలో వారికి సహాయం చేస్తుంది. తెలంగాణ మరియు ఆంధ్రప్రదేశ్ నుండి అన్ని వార్తలు మరియు అప్‌డేట్‌లను మీకు తెలియజేయడానికి మరియు నిమగ్నమై ఉండటానికి మా ప్రయాణంలో మాతో చేరండి. ఈరోజే Raj News వార్తలకు సబ్‌స్క్రయిబ్ చేసుకోండి మరియు మా విశ్వసనీయమైన మరియు సమగ్రమైన వార్తల కవరేజీలో ముందుండి. "Raj News Telugu" - All Types of News for Telangana & Andhra Pradesh" is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu News channel provides a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, Raj News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Join us on our journey to keep you informed and engaged with all the news and updates from Telangana and Andhra Pradesh. Subscribe to Raj News today and stay ahead of our reliable and comprehensive news coverage. ►Subscribe to Raj News LIVE : https://www.youtube.com/channel/UCVGRzd9YUtXYozquyYcjQOQ ►Like us on Facebook: https://www.facebook.com/rajnewsteluguofficial/ ►Follow us On Instagram: https://www.instagram.com/rajnewsdigital ►Follow us on Twitter: https://x.com/rajnewsdigital #RajNews #TelanganaNews #APNews

English · AI translation

Farmers’ queue line in Hanumakonda for fertilizers | Farmers Struggling For Fertilizers in Hanumakonda | Raj News Farmers’ queue line in Hanumakonda for fertilizers | Farmers Struggling For Fertilizers in Hanumakonda | Raj News "RAJ NEWS News Telugu" - All types of news for Telangana and Andhra Pradesh is a dynamic Telugu news channel dedicated to providing comprehensive and latest news coverage from the states of Telangana and Andhra Pradesh. Our Telugu news channel is a one-stop destination for viewers seeking information on a wide range of topics including politics, current affairs, business, sports, entertainment, technology, health and more. With a team of dedicated journalists and reporters, we strive to provide our audience with the latest developments, breaking news, exclusive interviews and in-depth analysis of issues affecting both states. Whether you are a resident of Telangana or Andhra Pradesh, a member of the Telugu diaspora or just interested in keeping up with happenings in these regions, Raj News has you covered. We aim to empower our viewers with accurate, unbiased and timely news coverage, helping them make informed decisions and stay connected with their communities. Join us on our journey to keep you informed and engaged with all the news and updates from Telangana and Andhra Pradesh. Subscribe to Raj News today and stay ahead with our reliable and comprehensive news coverage.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are standing in a queue for fertilizers in Hanumakonda.” · confidence 97%

Sentiment: negativeStance toward government: neutralTelangana relevance: 94%Agriculture relevance: 95%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2856ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:34
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:36
  3. ENRICHED · 9 Sept, 22:37
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 493c5a55 · raw item 565e45ab · origin live

YouTubeThe Telugu SphereMedia organisation86%5 Jul, 09:45 IST
Khammam (98% conf.)Telugu / Englishstance: critical742 views · 1 likes · 0 comments

పెరిగిన ఎరువు ధరలు మండిపడుతున్న రైతన్నలు | Khammam | Way2news Telugu

Original — Telugu / English

Khammam వార్తల కోసం Download వే2న్యూస్ App కేంద్ర ప్రభుత్వం పొటాష్ ధర పెంచడంతో జిల్లా రైతులపై అదనంగా రూ.8.87 కోట్ల భారం పడుతుంది. జిల్లావ్యాప్తంగా 5.91 లక్షల ఎకరాల్లో వివిధ పంటలు సాగవుతున్నాయి. ఈ లెక్కన 17,780 మెట్రిక్ టన్నుల పొటాష్ అవసరం ఉంటుందని వ్యవసాయాధికారులు అంచనా వేశారు. పెరిగిన ధర ప్రకారం సుమారు రూ.8.87 కోట్లు రైతులపై అదనపు భారం పడుతోంది. ఐదేళ్ల కింద 800 ఉన్న బస్తా ఇప్పుడు ధర రూ.1,800లకు చేరడం పట్ల రైతులు మండిపడుతున్నారు. The central governments increase in the price of potash will impose an additional burden of Rs 8.87 crore on the farmers of the district. Various crops are being grown in 5.91 lakh acres across the district. Agriculture officials have estimated that 17,780 metric tons of potash will be required. According to the increased price, an additional burden of about Rs 8.87 crore is being imposed on the farmers. Farmers are angry that the price of a bag, which was 800 five years ago, has now reached Rs 1,800.

Show full source text as published

పెరిగిన ఎరువు ధరలు మండిపడుతున్న రైతన్నలు | Khammam | Way2news Telugu Khammam వార్తల కోసం Download వే2న్యూస్ App కేంద్ర ప్రభుత్వం పొటాష్ ధర పెంచడంతో జిల్లా రైతులపై అదనంగా రూ.8.87 కోట్ల భారం పడుతుంది. జిల్లావ్యాప్తంగా 5.91 లక్షల ఎకరాల్లో వివిధ పంటలు సాగవుతున్నాయి. ఈ లెక్కన 17,780 మెట్రిక్ టన్నుల పొటాష్ అవసరం ఉంటుందని వ్యవసాయాధికారులు అంచనా వేశారు. పెరిగిన ధర ప్రకారం సుమారు రూ.8.87 కోట్లు రైతులపై అదనపు భారం పడుతోంది. ఐదేళ్ల కింద 800 ఉన్న బస్తా ఇప్పుడు ధర రూ.1,800లకు చేరడం పట్ల రైతులు మండిపడుతున్నారు. The central governments increase in the price of potash will impose an additional burden of Rs 8.87 crore on the farmers of the district. Various crops are being grown in 5.91 lakh acres across the district. Agriculture officials have estimated that 17,780 metric tons of potash will be required. According to the increased price, an additional burden of about Rs 8.87 crore is being imposed on the farmers. Farmers are angry that the price of a bag, which was 800 five years ago, has now reached Rs 1,800. #khammam #potashpricehike #fertilizercrisis #farmersprotest #agricultureissues #potashrates #farmersvoice #way2news #indianfarmers #fertilizercosts #agriculture #metrictons #centralgovernment #farmersburden #additionalburden #lakhacres #districtfarmers #variouscrops #cropcultivation #agriculturalresources #potashpriceincrease #agricultureofficials #way2news #way2newstelugu

English · AI translation

The increase in fertilizer prices is upsetting farmers. Because the central government has increased the price of potash, farmers in the district will face an additional burden of Rs 8.87 crore. Various crops are being cultivated across 5.91 lakh acres in the district. Agriculture officials estimate that 17,780 metric tons of potash will be required. At the increased price, farmers will face an additional burden of about Rs 8.87 crore. Farmers are angry that the price of a bag, which was Rs 800 five years ago, has now reached Rs 1,800.

fertilizer-availabilityinput-cost
Open original source ↗
AI interpretation & provenance
Extracted claim

“The district farmers will face an additional burden of Rs 8.87 crore due to the increase in potash prices.” · confidence 97%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2780ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:48
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention efc9a9bd · raw item 1b6acdb4 · origin live

YouTubeThe Veda SecretsMedia organisation74%1 Jul, 22:20 IST
Sangareddy · khed (96% conf.)Telugu / Englishstance: neutral812 views · 4 likes · 0 comments

ఖేడ్: 'రసాయన ఎరువులు అధికంగా వాడొద్దు' | Sangareddy | Way2news Telugu

Original — Telugu / English

Sangareddy వార్తల కోసం Download వే2న్యూస్ App రసాయన ఎరువులు మోతాదుకు మించి వాడొద్దని వ్యవసాయ శాస్త్రవేత్తలు సూచించారు. ఖేడ్ మండలంలోని లింగాపూర్ రైతు వేదికలో రైతు నేస్తం వీడియో కాన్ఫరెన్స్‌ను మంగళవారం ఉదయం నిర్వహించారు. ఈ సందర్భంగా రైతులకు చిరుధాన్యాల సాగులో మెలకువలను వ్యవసాయ శాస్త్రవేత్తలు వివరించారు. కార్యక్రమంలో క్లస్టర్ వ్యవసాయ విస్తరణ అధికారి సతీశ్, రైతులు పాల్గొన్నారు. Agricultural scientists have advised against using chemical fertilizers in excess. A farmers nest video conference was held at Lingapur Rythu Vedika in Khed mandal on Tuesday morning. On this occasion, agricultural scientists explained the techniques of cultivating small grains to the farmers. Cluster Agricultural Extension Officer Satish and farmers participated in the program.

Show full source text as published

ఖేడ్: 'రసాయన ఎరువులు అధికంగా వాడొద్దు' | Sangareddy | Way2news Telugu Sangareddy వార్తల కోసం Download వే2న్యూస్ App రసాయన ఎరువులు మోతాదుకు మించి వాడొద్దని వ్యవసాయ శాస్త్రవేత్తలు సూచించారు. ఖేడ్ మండలంలోని లింగాపూర్ రైతు వేదికలో రైతు నేస్తం వీడియో కాన్ఫరెన్స్‌ను మంగళవారం ఉదయం నిర్వహించారు. ఈ సందర్భంగా రైతులకు చిరుధాన్యాల సాగులో మెలకువలను వ్యవసాయ శాస్త్రవేత్తలు వివరించారు. కార్యక్రమంలో క్లస్టర్ వ్యవసాయ విస్తరణ అధికారి సతీశ్, రైతులు పాల్గొన్నారు. Agricultural scientists have advised against using chemical fertilizers in excess. A farmers nest video conference was held at Lingapur Rythu Vedika in Khed mandal on Tuesday morning. On this occasion, agricultural scientists explained the techniques of cultivating small grains to the farmers. Cluster Agricultural Extension Officer Satish and farmers participated in the program. #vedika #khedmandal #nestvideoconference #smallgrains #lingapur #rythu #khedmandal #tuesdaymorning #farmersnestvideoconference #khed #clusteragriculturalextensionofficersatish #lingapurrythuvedika #smallgrainscultivation #satish #clusteragriculturalextension #tuesday #farmers #agriculturalscientists #chemicalfertilizers #clusteragriculturalextensionofficersatish #lingapurrythuvedika #way2news #way2newstelugu

English · AI translation

Do not use chemical fertilizers in excess,' scientists advise | Sangareddy | Way2news Telugu For Sangareddy news, download the Way2News app. Agricultural scientists advised that chemical fertilizers should not be used beyond the required amount. A Rythu Nestham video conference was held on Tuesday morning at the Lingapur Rythu Vedika in Khed mandal. On this occasion, agricultural scientists explained to farmers the methods of cultivating small millets. Cluster Agricultural Extension Officer Satish and farmers participated in the program.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Agricultural scientists advised farmers not to use chemical fertilizers in excess.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 99%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2201ms)

Processing trail
  1. NORMALIZED · 11 Sept, 04:15
  2. RELEVANCE_ACCEPTED · 11 Sept, 04:15
  3. ENRICHED · 11 Sept, 04:16
  4. DEDUPED · 11 Sept, 04:16
  5. NARRATIVE_ASSIGNED · 11 Sept, 04:17
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 8980cfa0 · raw item 10b4f802 · origin live

YouTubeDD NEWS TelanganaMedia organisation99%1 Jul, 09:43 IST
Jagtial (98% conf.)Telugustance: neutral701 views · 4 likes · 0 comments

పంటలకు అవసరమైనంత ఎరువులు మాత్రమే వాడాలి | Jagtial District Agriculture Officer

Original — Telugu

పంటలకు అవసరమైనంత ఎరువులు మాత్రమే వాడాలని జగిత్యాల జిల్లా వ్యవసాయ అధికారి భాస్కర్ రైతులకు సూచించారు. వానాకాలం సీజన్‌లో వరి, మొక్కజొన్న, పసుపు పంటల సాగు ప్రారంభమైందని తెలిపారు

English · AI translation

Use only the required amount of fertilizers for crops | Jagtial District Agriculture Officer Jagtial District Agriculture Officer Bhaskar advised farmers to use only the required amount of fertilizers. He said that the cultivation of paddy, maize, and turmeric crops has begun in the monsoon season.

fertilizer-availabilitypaddymaizeturmeric
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Jagtial District Agriculture Officer Bhaskar advised farmers to use only the required amount of fertilizers.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3086ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:40
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 1afc0a8f · raw item 25798596 · origin live

YouTubeSreedeviboppana1Creator84%20 Jun, 14:49 IST
Sangareddy (88% conf.)Englishstance: neutral114 views · 6 likes · 0 comments

A day in my life//Some types of crops//Organic fertilizers @sreedeviboppana1 #sangareddy

Original — English

A day in my life//Some types of crops//Organic fertilizers ‎⁨@Sreedevi_Vlogs⁩  #sangareddy

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions organic fertilizers and some types of crops.” · confidence 74%

Sentiment: neutralStance toward government: neutralTelangana relevance: 60%Agriculture relevance: 70%Classification confidence: 80%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1616ms)

Processing trail
  1. NORMALIZED · 11 Sept, 04:15
  2. RELEVANCE_ACCEPTED · 11 Sept, 04:15
  3. ENRICHED · 11 Sept, 04:16
  4. DEDUPED · 11 Sept, 04:16
  5. NARRATIVE_ASSIGNED · 11 Sept, 04:17
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention e09acc6b · raw item 829d3686 · origin live

YouTubeFTR NEWS CHANNELMedia organisation93%19 Jun, 15:41 IST
Sangareddy · NizamPet (99% conf.)Englishstance: neutral525 views · 7 likes · 0 comments

Sangareddy Collector Inspects Fertilizer Shop NizamPet Mandal

Original — English

Sangareddy Collector Inspects Fertilizer Shop NizamPet Mandal

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The Sangareddy Collector inspected a fertilizer shop in NizamPet Mandal.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 88%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3148ms)

Processing trail
  1. NORMALIZED · 11 Sept, 04:15
  2. RELEVANCE_ACCEPTED · 11 Sept, 04:15
  3. ENRICHED · 11 Sept, 04:15
  4. DEDUPED · 11 Sept, 04:16
  5. NARRATIVE_ASSIGNED · 11 Sept, 04:17
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 16756e3e · raw item a9fd8c45 · origin live

Near-duplicateYouTubeFTR NEWS CHANNEL30 Jul, 19:37 ISTnot counted toward volume

Sangareddy Collector Inspects Fertilizer Shop

YouTubeSSC KARIMNAGAR NEWSMedia organisation90%18 Jun, 19:46 IST
Peddapalli (98% conf.)Telugustance: neutral2 views · 0 likes · 0 comments

నకిలీ ఎరువులు, విత్తనాలపై ప్రత్యేక దృష్టి ||SSC NEWS KARIMNAGAR ||18-06-2025||

Original — Telugu

#SSC #KARIMNAGAR #NEWS #నిజం...మా నైజం...

English · AI translation

Special focus on fake fertilizers and seeds || SSC NEWS KARIMNAGAR || 18-06-2025 || #SSC #KARIMNAGAR #NEWS #Truth...our character... Under the leadership of District Agriculture Officer Adireddy, surprise inspections were conducted at several fertilizer shops in Peddapalli district headquarters. On this occasion, the district officer said that strict action would be taken against those selling fake fertilizers and fake seeds, and instructed that details of seed stocks must be displayed mandatorily and expired medicines and seeds should be sent back to the companies. ADA Srinath and AO Aliveni participated in this programme. In the town, seed sales are currently taking place in four seed shops, so inspections were carried out at the counters where farmers are buying seeds. It was said that all types of companies' seeds are available, that seeds are being sold today according to farmers' choice, and that there is no adulteration in seeds anywhere. It was also stated that if the MRP is exceeded, for example if the MRP is 901 rupees, the average rate sold by dealers to farmers is 850 rupees. It is the government's focus to provide seeds to farmers without exceeding the MRP and without adulteration, and as part of that, all agricultural officials are monitoring it so that farmers do not suffer losses anywhere. Earlier we had seen one, right? That marketing-related licence also came. That also reached us on the phone, and after taking a printout we will give it. It is visible inside that too. If sold at higher prices, immediate action will be taken. We are also giving the number to farmers themselves: if they call 897752780, the agricultural department will be informed immediately and prompt action will be taken and a case will be filed.

fertilizer-availabilityseedsinput-costfake-seeds
Open original source ↗
AI interpretation & provenance
Extracted claim

“District agriculture officials in Peddapalli district inspected several fertilizer shops and said strict action would be taken against those selling fake fertilizers or fake seeds.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4455ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:35
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  7. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention e591a6ac · raw item 68ed441a · origin live

YouTubeBCN Telugu NewsMedia organisation98%6 Jun, 14:57 IST
Mulugu (99% conf.)Telugustance: neutral805 views · 1 likes · 0 comments

ఎరువుల దుకాణాలను ఆకస్మిక తనిఖీ చేసిన ములుగు జిల్లా కలెక్టర్ దివాకర్ టిఎస్ || #bcntelugunews

Original — Telugu

Bcn Telugu News

Show full source text as published

ఎరువుల దుకాణాలను ఆకస్మిక తనిఖీ చేసిన ములుగు జిల్లా కలెక్టర్ దివాకర్ టిఎస్ || #bcntelugunews Bcn Telugu News #BcnteluguNews #TeluguNewsLive #BCNNews #AP_TS_TeluguNews

English · AI translation

Mulugu district collector Diwakar TS conducted a surprise inspection of fertilizer shops || #bcntelugunews Bcn Telugu News

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Mulugu district collector Diwakar TS conducted a surprise inspection of fertilizer shops.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1876ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention cd6a8fa8 · raw item b04b8df5 · origin live

YouTubeBalagam Tv SircillaMedia organisation90%5 Jun, 15:04 IST
Rajanna Sircilla · Vemulawada (96% conf.)Telugustance: neutral12 views · 0 likes · 0 comments

వేములవాడ పట్టణంలో ఎరువులు విత్తనాల దుకాణాలను, గోశాలను ఆకస్మిక తనిఖీ చేసిన జిల్లా కలెక్టర్|Balagam Tv

Original — Telugu

వేములవాడ పట్టణంలోని రాజన్న గోశాల పరిసరాలు స్వయంగా తిరిగి పరిశీలించి, ఎరువులు విత్తనాల దుకాణాలను ఆకస్మికంగా తనిఖీ చేసిన జిల్లా కలెక్టర్ సందీప్‍ కుమార్‍ ఝా.. | Balagam Tv

Show full source text as published

వేములవాడ పట్టణంలో ఎరువులు విత్తనాల దుకాణాలను, గోశాలను ఆకస్మిక తనిఖీ చేసిన జిల్లా కలెక్టర్|Balagam Tv #balagamtvsircilla #balagamtv #sircilla వేములవాడ పట్టణంలోని రాజన్న గోశాల పరిసరాలు స్వయంగా తిరిగి పరిశీలించి, ఎరువులు విత్తనాల దుకాణాలను ఆకస్మికంగా తనిఖీ చేసిన జిల్లా కలెక్టర్ సందీప్‍ కుమార్‍ ఝా.. | Balagam Tv

English · AI translation

The district collector conducted a surprise inspection of fertilizer and seed shops and the gaushala in Vemulawada town. District Collector Sandeep Kumar Jha personally inspected the surroundings of Rajanna Gaushala in Vemulawada town and conducted a surprise inspection of fertilizer and seed shops.

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The district collector conducted a surprise inspection of fertilizer and seed shops in Vemulawada town.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 86%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1910ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 95106788 · raw item 929a5fb5 · origin live

YouTubeS6 News Karimnagar Media organisation99%5 Jun, 15:04 IST
Rajanna Sircilla · Vemulawada (96% conf.)Telugustance: neutral82 views · 2 likes · 0 comments

వేములవాడలోని ఎరువులు, విత్తనాల దుకాణాల్లో కలెక్టర్ ఆకస్మిక తనిఖీ | S6 News Karimnagar

Original — Telugu

వేములవాడలోని ఎరువులు, విత్తనాల దుకాణాల్లో కలెక్టర్ ఆకస్మిక తనిఖీ | S6 News Karimnagar

Show full source text as published

వేములవాడలోని ఎరువులు, విత్తనాల దుకాణాల్లో కలెక్టర్ ఆకస్మిక తనిఖీ | S6 News Karimnagar వేములవాడలోని ఎరువులు, విత్తనాల దుకాణాల్లో కలెక్టర్ ఆకస్మిక తనిఖీ | S6 News Karimnagar #SeedInspection #FertilizerCheck #RajannaSircilla #CollectorAction #ProtectFarmers #QualitySeeds #NoFakeFertilizers #FarmerSafety #AgricultureIntegrity #FightSeedScam #SupportFarmers #StopSeedFraud #FarmersRights About Channel: S6 News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Karimnagar, S6 News Network covers news from every corner of Telugu States. We at S6 News Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: / s6news Follow Us On Instagram: / s6news Follow Us On Twitter: / s6news

English · AI translation

Collector conducts surprise inspection at fertilizer and seed shops in Vemulawada | S6 News Karimnagar

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The collector conducted a surprise inspection of fertilizer and seed shops in Vemulawada.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 99%Agriculture relevance: 98%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1584ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:39
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention be444884 · raw item e0886b0d · origin live

YouTubeTelugu Health GuruMedia organisation84%5 Jun, 14:33 IST
Rajanna Sircilla · Vemulawada (98% conf.)Telugu / Englishstance: neutral1,045 views · 3 likes · 0 comments

రైతులకు నాణ్యమైన విత్తనాలు విక్రయించాలి: కలెక్టర్ | Rajanna Sircilla | undefined | Way2news Telugu

Original — Telugu / English

Rajanna Sircilla వార్తల కోసం Download వే2న్యూస్ App వేములవాడలోని పలు విత్తనాలు, ఎరువుల విక్రయ దుకాణాలను కలెక్టర్ సందీప్ కుమార్ ఝా గురువారం ఆకస్మికంగా తనిఖీ చేశారు. రైతులకు నాణ్యమైన విత్తనాలు విక్రయించాలన్నారు. క్రయ విక్రయాలు జరిపిన సమయంలో వివరాలను రికార్డులో తప్పక నమోదు చేయాలన్నారు. రైతులను మోసం చేస్తే చర్యలు తప్పవని హెచ్చరించారు. ఆయన వెంట జిల్లా వ్యవసాయ శాఖ అధికారులు ఉన్నారు. Collector Sandeep Kumar Jha conducted a surprise inspection of several seed and fertilizer sales shops in Vemulawada on Thursday. He said that quality seeds should be sold to farmers. Details should be recorded at the time of purchase and sale. He warned that action will be taken if farmers are cheated. He was accompanied by officials of the district agriculture department.

Show full source text as published

రైతులకు నాణ్యమైన విత్తనాలు విక్రయించాలి: కలెక్టర్ | Rajanna Sircilla | undefined | Way2news Telugu Rajanna Sircilla వార్తల కోసం Download వే2న్యూస్ App వేములవాడలోని పలు విత్తనాలు, ఎరువుల విక్రయ దుకాణాలను కలెక్టర్ సందీప్ కుమార్ ఝా గురువారం ఆకస్మికంగా తనిఖీ చేశారు. రైతులకు నాణ్యమైన విత్తనాలు విక్రయించాలన్నారు. క్రయ విక్రయాలు జరిపిన సమయంలో వివరాలను రికార్డులో తప్పక నమోదు చేయాలన్నారు. రైతులను మోసం చేస్తే చర్యలు తప్పవని హెచ్చరించారు. ఆయన వెంట జిల్లా వ్యవసాయ శాఖ అధికారులు ఉన్నారు. Collector Sandeep Kumar Jha conducted a surprise inspection of several seed and fertilizer sales shops in Vemulawada on Thursday. He said that quality seeds should be sold to farmers. Details should be recorded at the time of purchase and sale. He warned that action will be taken if farmers are cheated. He was accompanied by officials of the district agriculture department. #fertilizersalesshops #qualityseeds #recordkeeping #fertilizersales #seedsales #kumarjha #sandeep #collector #collectorinspection #farmerprotection #sandeepkumarjha #agriculturedepartment #severalseed #surpriseinspection #thursday #thedistrictagriculturedepartment #vemulawada #way2news #way2newstelugu

English · AI translation

Collector Sandeep Kumar Jha conducted a surprise inspection of several seed and fertilizer sales shops in Vemulawada on Thursday. He said that quality seeds should be sold to farmers. Details should be recorded at the time of purchase and sale. He warned that action will be taken if farmers are cheated. He was accompanied by officials of the district agriculture department.

seedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Collector Sandeep Kumar Jha conducted a surprise inspection of several seed and fertilizer sales shops in Vemulawada.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2037ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:59
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  7. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  20. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 18feb736 · raw item 8121ac7f · origin live

YouTubeThe Vedic TruthsMedia organisation88%3 Jun, 22:35 IST
Vikarabad · Vikarabad (98% conf.)Telugustance: neutral11 views · 0 likes · 0 comments

వికారాబాద్ మండల రైతులకు ముఖ్య గమనిక | Vikarabad | undefined | Way2news Telugu

Original — Telugu

Vikarabad వార్తల కోసం Download వే2న్యూస్ App వికారాబాద్ మండలం నారాయణపూర్ రైతువేదికలో ఎరువులు, విత్తనాలు అందుబాటులో ఉన్నాయని, కావాల్సిన వారు కొనుగోలు చేయవచ్చని ఏఈవో సరిత అన్నారు. మంగళవారం నారాయణపూర్‌లోని రైతువేదికలో రాష్ట్ర వ్యవసాయ సెక్రటరీ వీడియో కాన్ఫరెన్స్ ద్వారా రైతులకు అవగాహన సదస్సును నిర్వహించారు. అనంతరం ఏఈవో మాట్లాడారు. పంటల సాగులో ఏవైనా సందేహాలు వస్తే తనను సంప్రదించాలన్నారు. AEO Saritha said that fertilizers and seeds are available at the Narayanpur Rythu Vedika in Vikarabad Mandal and those who need them can buy them. On Tuesday, the State Agriculture Secretary organized an awareness seminar for farmers through video conference at the Rythu Vedika in Narayanpur. The AEO spoke afterwards. If you have any doubts about crop cultivation, you should contact her.

Show full source text as published

వికారాబాద్ మండల రైతులకు ముఖ్య గమనిక | Vikarabad | undefined | Way2news Telugu Vikarabad వార్తల కోసం Download వే2న్యూస్ App వికారాబాద్ మండలం నారాయణపూర్ రైతువేదికలో ఎరువులు, విత్తనాలు అందుబాటులో ఉన్నాయని, కావాల్సిన వారు కొనుగోలు చేయవచ్చని ఏఈవో సరిత అన్నారు. మంగళవారం నారాయణపూర్‌లోని రైతువేదికలో రాష్ట్ర వ్యవసాయ సెక్రటరీ వీడియో కాన్ఫరెన్స్ ద్వారా రైతులకు అవగాహన సదస్సును నిర్వహించారు. అనంతరం ఏఈవో మాట్లాడారు. పంటల సాగులో ఏవైనా సందేహాలు వస్తే తనను సంప్రదించాలన్నారు. AEO Saritha said that fertilizers and seeds are available at the Narayanpur Rythu Vedika in Vikarabad Mandal and those who need them can buy them. On Tuesday, the State Agriculture Secretary organized an awareness seminar for farmers through video conference at the Rythu Vedika in Narayanpur. The AEO spoke afterwards. If you have any doubts about crop cultivation, you should contact her. #vedika #cropcultivation #narayanpurrythuvedika #aeosaritha #videoconference #fertilizers #cropcultivation #aeo #rythuvedika #secretary #mandal #rythuvedika #videoconference #agriculture #stateagriculturesecretary #tuesday #stateagriculture #farmers #awarenessseminar #vikarabadmandal #vikarabadmandal #stateagriculturesecretary #seeds #aeosaritha #vikarabad #narayanpur #narayanpur #rythu #way2news #way2newstelugu

English · AI translation

AEO Saritha said that fertilizers and seeds are available at the Narayanpur Rythu Vedika in Vikarabad Mandal and those who need them can buy them. On Tuesday, the State Agriculture Secretary organized an awareness seminar for farmers through video conference at the Rythu Vedika in Narayanpur. The AEO spoke afterwards. If you have any doubts about crop cultivation, you should contact her.

fertilizer-availabilityseedsseed-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Fertilizers and seeds are available at the Narayanpur Rythu Vedika in Vikarabad Mandal for those who want to buy them.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2517ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  12. NARRATIVE_ASSIGNED · 20 Sept, 05:57

mention 4639b72a · raw item 8c3f5ee5 · origin live

YouTubeTelangana FrameMedia organisation78%1 Jun, 21:54 IST
Karimnagar · chigurumamidi (96% conf.)Telugu / Englishstance: neutral17 views · 0 likes · 0 comments

చిగురుమామీడి: ‘సేంద్రియ ఎరువుల వాడకంపై రైతులు దృష్టి పెట్టాలి’ | Karimnagar | Telangana | Way2new..

Original — Telugu / English

Karimnagar వార్తల కోసం Download వే2న్యూస్ App అధిక సాగు దిగుబడికి కృతిమ రసాయనిక ఎరువులు వాడడం వల్ల క్యాన్సర్ బారిన పడే ప్రమాదం ఉందని వ్యవసాయ శాస్త్రవేత్త శ్రీనివాస్ రెడ్డి తెలిపారు. శనివారం చిగురుమామిడి(M) ఇందుర్తి రైతు వేదికలో నిర్వహించిన వికసిత్ కృషి అభియాన్ సంకల్ప కార్యక్రమంలో ఆయన పాల్గొన్నారు. సేంద్రియ ఎరువుల వాడకంపై రైతులు దృష్టి కేంద్రీకరించాలని విజ్ఞప్తి చేశారు. రైతులకు సాగు విషయంలో ఎలాంటి అనుమానాలు అన్న అధికారులను సంప్రదించాలన్నారు. Agricultural scientist Srinivas Reddy said that there is a risk of cancer due to the use of synthetic chemical fertilizers for high crop yields. He participated in the Vikasith Krishi Abhiyan Sankalpa program organized at the Indurthi Rythu Vedika in Chigurumamidi (M) on Saturday. He appealed to farmers to focus on the use of organic fertilizers. Farmers should contact the authorities if they have any doubts about cultivation.

Show full source text as published

చిగురుమామీడి: ‘సేంద్రియ ఎరువుల వాడకంపై రైతులు దృష్టి పెట్టాలి’ | Karimnagar | Telangana | Way2new.. Karimnagar వార్తల కోసం Download వే2న్యూస్ App అధిక సాగు దిగుబడికి కృతిమ రసాయనిక ఎరువులు వాడడం వల్ల క్యాన్సర్ బారిన పడే ప్రమాదం ఉందని వ్యవసాయ శాస్త్రవేత్త శ్రీనివాస్ రెడ్డి తెలిపారు. శనివారం చిగురుమామిడి(M) ఇందుర్తి రైతు వేదికలో నిర్వహించిన వికసిత్ కృషి అభియాన్ సంకల్ప కార్యక్రమంలో ఆయన పాల్గొన్నారు. సేంద్రియ ఎరువుల వాడకంపై రైతులు దృష్టి కేంద్రీకరించాలని విజ్ఞప్తి చేశారు. రైతులకు సాగు విషయంలో ఎలాంటి అనుమానాలు అన్న అధికారులను సంప్రదించాలన్నారు. Agricultural scientist Srinivas Reddy said that there is a risk of cancer due to the use of synthetic chemical fertilizers for high crop yields. He participated in the Vikasith Krishi Abhiyan Sankalpa program organized at the Indurthi Rythu Vedika in Chigurumamidi (M) on Saturday. He appealed to farmers to focus on the use of organic fertilizers. Farmers should contact the authorities if they have any doubts about cultivation. #highcropyields #organicfarming #indurthirythuvedika #sankalpa #krishi #vikasithkrishiabhiyansankalpaprogram #cancerrisk #srinivasreddy #srinivasreddy #agriculture #cropyields #agricultural #fertilizers #syntheticchemicalfertilizers #abhiyan #indurthirythuvedika #saturday #chigurumamidi #syntheticchemicals #vikasith #vikasithkrishiabhiyan #organicfertilizers #theindurthirythuvedika #farmerawareness #way2news #way2newstelugu

English · AI translation

Chigurumamidi: ‘Farmers should focus on the use of organic fertilizers’ | Karimnagar | Telangana | Way2new.. For Karimnagar news, download the Way2News app. Agricultural scientist Srinivas Reddy said that there is a risk of cancer due to the use of synthetic chemical fertilizers for high crop yields. He participated in the Vikasith Krishi Abhiyan Sankalpa program organized at the Indurthi Rythu Vedika in Chigurumamidi (M) on Saturday. He appealed to farmers to focus on the use of organic fertilizers. Farmers should contact the authorities if they have any doubts about cultivation.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Agricultural scientist Srinivas Reddy said that using synthetic chemical fertilizers for high crop yields carries a risk of cancer.” · confidence 78%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 94%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2388ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:29
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention f4fc68ea · raw item ba3a443a · origin live

Syndicated copyYouTubeTelugu Health Guru1 Jun, 21:54 ISTnot counted toward volume

చిగురుమామీడి: ‘సేంద్రియ ఎరువుల వాడకంపై రైతులు దృష్టి పెట్టాలి’ | Karimnagar | Telangana | Way2new..

YouTubeT News teluguMedia organisation96%27 May, 16:43 IST
Sangareddy (97% conf.)Telugustance: neutral153 views · 0 likes · 0 comments
Was live

Sangareddy : విత్తనాలు, ఎరువుల కోసం రైతుల ఎదురుచూపులు | T News

Original — Telugu

Sangareddy : విత్తనాలు, ఎరువుల కోసం రైతుల ఎదురుచూపులు | T News

Show full source text as published

Sangareddy : విత్తనాలు, ఎరువుల కోసం రైతుల ఎదురుచూపులు | T News Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://bit.ly/4ioUBxV ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

English · AI translation

Sangareddy: Farmers are waiting for seeds and fertilizers | T News

seedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Sangareddy are waiting for seeds and fertilizers.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 95%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1501ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  12. NARRATIVE_ASSIGNED · 20 Sept, 05:57

mention a4d438fb · raw item 76562a9d · origin live

YouTubeDurga Siti CableMedia organisation97%26 May, 21:20 IST
Jagtial (99% conf.)Telugustance: neutral60 views · 0 likes · 0 comments

విత్తన మరియు ఎరువుల డీలర్లతో జగిత్యాల జిల్లా కలెక్టర్ సత్య ప్రసాద్ సమావేశం

Original — Telugu

| Durga Siti Cable News | Jagtial | 26.05.2025 | విత్తన మరియు ఎరువుల డీలర్లతో జగిత్యాల జిల్లా కలెక్టర్ సత్య ప్రసాద్ సమావేశం * Watch Durga Siti Cable News Everyday at 9.30pm & 8.30am * Social Media Finds New Role as News and Entertainment Curator

Show full source text as published

విత్తన మరియు ఎరువుల డీలర్లతో జగిత్యాల జిల్లా కలెక్టర్ సత్య ప్రసాద్ సమావేశం | Durga Siti Cable News | Jagtial | 26.05.2025 | విత్తన మరియు ఎరువుల డీలర్లతో జగిత్యాల జిల్లా కలెక్టర్ సత్య ప్రసాద్ సమావేశం * Watch Durga Siti Cable News Everyday at 9.30pm & 8.30am * Social Media Finds New Role as News and Entertainment Curator Watch #Live: http://www.durgasiticable.in/ Subscribe our YouTube Channel ► https://www.youtube.com/c/durgasiticable Visit our Website ►http://www.durgasiticable.in Facebook ►https://www.facebook.com/durgasiticable Twitter ► https://twitter.com/durgasiticable

English · AI translation

Meeting of Jagtial district collector Satya Prasad with seed and fertilizer dealers. Durga Siti Cable News | Jagtial | 26.05.2025 | Meeting of Jagtial district collector Satya Prasad with seed and fertilizer dealers. Watch Durga Siti Cable News every day at 9.30 pm & 8.30 am Social Media Finds New Role as News and Entertainment Curator

seedsfertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Jagtial district collector Satya Prasad held a meeting with seed and fertilizer dealers.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4534ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 86c8eb0b · raw item 886dd5c6 · origin live

YouTubeV6 News TeluguMedia organisation99%23 May, 18:34 IST
Jangaon · Palakurthy (93% conf.)Telugu / Englishstance: neutral512 views · 4 likes · 0 comments

Jangaon Collector Rizwan Basha Sudden Inspects At Fertilizer Shops In Palakurthy | V6 News

Original — Telugu / English

Watch Teenmaar Full Episode అయ్యా..ఎస్ లెక్కుండద్దు ఆ నోటీస్ రైతులకిచ్చినట్టే వర్షాలు దంచుడే పెద్దన్న ఎన్ కౌంటర్ గ్రూప్-3, గ్రూప్-4కు ఒకటే పరీక్ష? ఒక్కపారే 3 నెల్ల రేషన్? కుంకీ ఏనుగులొచ్చినయ్ పులిని సంపేశి ఏటీఎమే దిక్కైంది కన్నడ మాట్లాడనందుకు Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News".

Show full source text as published

Jangaon Collector Rizwan Basha Sudden Inspects At Fertilizer Shops In Palakurthy | V6 News Jangaon Collector Rizwan Basha Sudden Inspects At Fertilizer Shops In Palakurthy | V6 News Watch Teenmaar Full Episode https://youtu.be/4wzIj2tkXss అయ్యా..ఎస్ లెక్కుండద్దు https://youtu.be/bRO1K0TyJHY ఆ నోటీస్ రైతులకిచ్చినట్టే https://youtu.be/-nLtzQ7hT0U వర్షాలు దంచుడే https://youtu.be/Swxvpwzo-b0 పెద్దన్న ఎన్ కౌంటర్ https://youtu.be/bV_rBeyLctA గ్రూప్-3, గ్రూప్-4కు ఒకటే పరీక్ష? https://youtu.be/1YWZ5gY8lOQ ఒక్కపారే 3 నెల్ల రేషన్? https://youtu.be/_SWAWr6H1_Q కుంకీ ఏనుగులొచ్చినయ్ https://youtu.be/UuP5SL6TpMY పులిని సంపేశి https://youtu.be/4-10yHRoILI ఏటీఎమే దిక్కైంది https://youtu.be/rUBuH2s9BFE కన్నడ మాట్లాడనందుకు https://youtu.be/jb-drhSNu2s Watch LIVE Stream : https://www.youtube.com/watch?v=nrb8P8shbDk ► Subscribe to V6 News : https://www.youtube.com/c/V6NewsTelugu ► Subscribe to V6 Life : https://www.youtube.com/c/V6Life ► Follow Us On Dailymotion : https://www.dailymotion.com/v6newstelugu ► Like us on Facebook : http://www.facebook.com/V6News.tv ► Follow us on Instagram : https://www.instagram.com/v6newstelugu/ ► Follow us on Twitter : https://twitter.com/V6News ► Visit Website : http://www.v6velugu.com/ ► Join Us On Telegram : https://t.me/V6NewsTelugu Watch V6 Programs Here ►Teenmaar : https://rb.gy/qn91pg ►Trending Videos : https://rb.gy/f6i0x2 ►Top News : https://rb.gy/wqjeun ►HD Playlist : https://rb.gy/veit87 ►Innerview : https://rb.gy/83izwa ►Medaram Jatara : https://rb.gy/mn4tu7 ►Chandravva : https://rb.gy/nja3cl ►Spotlight : https://rb.gy/4lfm9s ►Dhoom Thadaka : https://rb.gy/hvytxl ►V6 Songs : https://rb.gy/68n90s ►Life Mates : https://rb.gy/itvwfa News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel Also Airs programs like Teenmaar News, Chandravva & Padma Satires etc, Theertham, Muchata (Celeb Interviews) Cinema Talkies, City Nazaria(Prog Describes The Most Happening &Visiting Places In Hyderabad),Mana Palle(Describes Villages And Specialities), Also V6 News Channel Is Famous For 'Bonalu Songs', 'Bathukamma Songs' And Other Seasonal And Folk Related Songs."V6Teenmaar News", "Teenmaar News". #jangon #collector #fertilizer #V6News #V6 #V6Velugu #TelanganaNews #Telangana

English · AI translation

Jangaon Collector Rizwan Basha sudden inspects at fertilizer shops in Palakurthy | V6 News Watch Teenmaar Full Episode Hey, don’t do it recklessly That notice was given to farmers The rains are beating down Big brother encounter Group-3, Group-4 have the same exam? Three months' ration at once? Kumki elephants have come The tiger has been killed ATMs have become the only support Because he did not speak Kannada Watch V6 Programs Here News content that serves the interests of Telangana and Andhra Pradesh viewers in the most receptive formats. V6 News channel also airs programs like Teenmaar News, Chandravva & Padma satires etc, Theertham, Muchata (celebrity interviews) Cinema Talkies, City Nazaria (program describes the most happening & visiting places in Hyderabad), Mana Palle (describes villages and specialties), Also V6 News Channel is famous for 'Bonalu songs', 'Bathukamma songs' and other seasonal and folk related songs. "V6 Teenmaar News", "Teenmaar News".

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Jangaon Collector Rizwan Basha suddenly inspected fertilizer shops in Palakurthy.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 92%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2558ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:29
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 37acdc6a · raw item 3c6e24b8 · origin live

YouTubeRTV NalgondaMedia organisation96%13 May, 17:49 IST
Nalgonda (96% conf.)Telugustance: neutral228 views · 5 likes · 0 comments

నకిలీ విత్తనాలు, ఎరువుల కొనుగోలుపై మోసపోకుండా ఈ జాగ్రత్తలు తీసుకోండి.. | RTV Nalgonda

Original — Telugu

నకిలీ విత్తనాలు, ఎరువుల కొనుగోలుపై మోసపోకుండా ఈ జాగ్రత్తలు తీసుకోండి.. | RTV Nalgonda

Show full source text as published

నకిలీ విత్తనాలు, ఎరువుల కొనుగోలుపై మోసపోకుండా ఈ జాగ్రత్తలు తీసుకోండి.. | RTV Nalgonda నకిలీ విత్తనాలు, ఎరువుల కొనుగోలుపై మోసపోకుండా ఈ జాగ్రత్తలు తీసుకోండి.. | RTV Nalgonda #rtvnews #rtvnalgonda #latestnews ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Take these precautions so you do not get cheated while buying fake seeds and fertilizers.. | RTV Nalgonda

seedsfertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content warns viewers to take precautions so they are not cheated when buying fake seeds and fertilizers.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 95%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2555ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention fb3aa39d · raw item 2d138d45 · origin live

YouTubeRTV KarimnagarMedia organisation98%8 Apr, 11:57 IST
Peddapalli (93% conf.)Telugu / Englishstance: neutral74 views · 0 likes · 0 comments

రామగుండం ఎరువుల కర్మాగారం రికార్డు | Ramagundam Fertilizer Factory Sets Record | RTV Karimnagar

Original — Telugu / English

రామగుండం ఎరువుల కర్మాగారం రికార్డు | Ramagundam Fertilizer Factory Sets Record | RTV Karimnagar

Show full source text as published

రామగుండం ఎరువుల కర్మాగారం రికార్డు | Ramagundam Fertilizer Factory Sets Record | RTV Karimnagar రామగుండం ఎరువుల కర్మాగారం రికార్డు | Ramagundam Fertilizer Factory Sets Record | RTV Karimnagar #ramagundam #fertilizerfactory #rtvkarimnagar ►For More News Updates, Visit : https://www.rtvlive.com ►Download Our Android APP : https://play.google.com/store/apps/details?id=com.rtvnewsnetwork.rtv ► Download Our IOS App : https://appstoreconnect.apple.com/apps/6466401505/appstore About Channel: RTV News Network is your top source for reliable, Unbiased news updates from Telugu States and across the globe. Operating Out of Hyderabad, RTV Network covers news from every corner of Telugu States. We at RTV Network, favour high-quality programming and news, rather than sensational infotainment. ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Please visit our Social Media pages for regular updates: Like Us On Facebook: https://www.facebook.com/RTVTeluguNews/ Follow Us On Instagram: https://www.instagram.com/rtvnewsnetwork/ Follow Us On Twitter: https://twitter.com/RTVnewsnetwork

English · AI translation

Ramagundam Fertilizer Factory Sets Record | RTV Karimnagar

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Ramagundam Fertilizer Factory sets a record.” · confidence 83%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 92%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1640ms)

Processing trail
  1. NORMALIZED · 10 Sept, 05:56
  2. RELEVANCE_ACCEPTED · 10 Sept, 05:56
  3. ENRICHED · 10 Sept, 05:57
  4. DEDUPED · 10 Sept, 05:57
  5. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 2bb72282 · raw item 758c28f0 · origin live

YouTubeGOODNEWS BUZZMedia organisation88%6 Mar, 17:42 IST
Yadadri Bhuvanagiri · Janakipuram (96% conf.)Telugu / Englishstance: neutral43 views · 1 likes · 0 comments

రైతుల ఆవేదన..| Farmers Protest with Pesticides in Yadadri Bhuvanagiri District | Telangana

Original — Telugu / English

రైతుల ఆవేదన..| Farmers Protest with Pesticides in Yadadri Bhuvanagiri District | Telangana #formers #yadadribhuvanagiri #yadadri #janakipuram #agriculture #agricultural #pesticides #fertilizer #water #waterproblem #formersprotest #telanganaagriculture #telanganaformers #cmrevanthreddy #revanthreddy #modi #pmmodi #narendramodi #congress #kishanreddy #bjp #rahulgandhi #slbc #slbcnews #politicalnews #telangananews #telanganapolitics #appolitics #apnews #pawankalyan #chandrababu #janasena #tdp #warangal #ktr #kcr #kavitha #brs #trending #trendingnews #trendingvideo #viralnews #viralvideo #latestnews #goodnewsind GOODNEWS INDIA covers a wide range of news, including politics, business, Agriculture, sports, entertainment, and current affairs. Our young, dynamic, and enthusiastic team of professionals with vast industry experience makes GOODNEWS INDIA a comprehensive and reliable news channel.@Goodnewsbuzz Links GOODNEWS INDIA goodnewsind.com X x.com/GOODNEWS_IND

Show full source text as published

రైతుల ఆవేదన..| Farmers Protest with Pesticides in Yadadri Bhuvanagiri District | Telangana రైతుల ఆవేదన..| Farmers Protest with Pesticides in Yadadri Bhuvanagiri District | Telangana #formers #yadadribhuvanagiri #yadadri #janakipuram #agriculture #agricultural #pesticides #fertilizer #water #waterproblem #formersprotest #telanganaagriculture #telanganaformers #cmrevanthreddy #revanthreddy #modi #pmmodi #narendramodi #congress #kishanreddy #bjp #rahulgandhi #slbc #slbcnews #politicalnews #telangananews #telanganapolitics #appolitics #apnews #pawankalyan #chandrababu #janasena #tdp #warangal #ktr #kcr #kavitha #brs #trending #trendingnews #trendingvideo #viralnews #viralvideo #latestnews #goodnewsind GOODNEWS INDIA covers a wide range of news, including politics, business, Agriculture, sports, entertainment, and current affairs. Our young, dynamic, and enthusiastic team of professionals with vast industry experience makes GOODNEWS INDIA a comprehensive and reliable news channel.@Goodnewsbuzz Links GOODNEWS INDIA goodnewsind.com FACEBOOK facebook.com/GoodnewsInd0123 INSTAGRAM instagram.com/goodnews_ind X x.com/GOODNEWS_IND

English · AI translation

Farmers' distress..| Farmers Protest with Pesticides in Yadadri Bhuvanagiri District | Telangana Farmers' distress..| Farmers Protest with Pesticides in Yadadri Bhuvanagiri District | Telangana #farmers #yadadribhuvanagiri #yadadri #janakipuram #agriculture #agricultural #pesticides #fertilizer #water #waterproblem #farmersprotest #telanganaagriculture #telanganafarmers #cmrevanthreddy #revanthreddy #modi #pmmodi #narendramodi #congress #kishanreddy #bjp #rahulgandhi #slbc #slbcnews #politicalnews #telangananews #telanganapolitics #appolitics #apnews #pawankalyan #chandrababu #janasena #tdp #warangal #ktr #kcr #kavitha #brs #trending #trendingnews #trendingvideo #viralnews #viralvideo #latestnews #goodnewsind GOODNEWS INDIA covers a wide range of news, including politics, business, Agriculture, sports, entertainment, and current affairs. Our young, dynamic, and enthusiastic team of professionals with vast industry experience makes GOODNEWS INDIA a comprehensive and reliable news channel.

crop-damagefertilizer-availabilityinput-cost
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers protested in Yadadri Bhuvanagiri District, Telangana.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 4150ms)

Processing trail
  1. NORMALIZED · 11 Sept, 11:18
  2. RELEVANCE_ACCEPTED · 11 Sept, 11:18
  3. ENRICHED · 11 Sept, 11:19
  4. DEDUPED · 11 Sept, 11:21
  5. NARRATIVE_ASSIGNED · 11 Sept, 11:21
  6. NARRATIVE_ASSIGNED · 11 Sept, 11:21
  7. NARRATIVE_ASSIGNED · 11 Sept, 11:21
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:45
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  16. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  17. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  18. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  19. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  20. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  21. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  22. NARRATIVE_ASSIGNED · 17 Sept, 21:02
  23. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  24. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  25. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  26. NARRATIVE_ASSIGNED · 20 Sept, 19:45
  27. NARRATIVE_ASSIGNED · 20 Sept, 23:13
  28. NARRATIVE_ASSIGNED · 21 Sept, 01:29
  29. NARRATIVE_ASSIGNED · 21 Sept, 11:16
  30. NARRATIVE_ASSIGNED · 21 Sept, 22:42
  31. NARRATIVE_ASSIGNED · 22 Sept, 05:32

mention 7470fa7f · raw item c9d7c953 · origin live

YouTubeBJP TelanganaPolitician98%25 Feb, 20:30 IST
District not evidencedTelugustance: supportive176 views · 19 likes · 2 comments

తెలంగాణాలో అవసరానికి సరిపడా ఎరువులకన్నా ఎక్కువ ఎరువులు కేంద్ర ప్రభుత్వం తెలంగాణాకి సరఫరా చేసింది

Original — Telugu

తెలంగాణాలో అవసరానికి సరిపడా ఎరువులకన్నా ఎక్కువ ఎరువులు కేంద్ర ప్రభుత్వం తెలంగాణాకి సరఫరా చేసింది.. ప్రధాని నరేంద్ర మోదీ గారిపై, బిజెపిపై బురదజల్లేందుకే కొంతమంది కావాలని కృత్రిమంగా ఎరువుల కొరత సృష్టిస్తున్నారు! - శ్రీ కిషన్ రెడ్డి గారు, కేంద్ర మంత్రివర్యులు, బిజెపి రాష్ట్ర అధ్యక్షులు

Show full source text as published

తెలంగాణాలో అవసరానికి సరిపడా ఎరువులకన్నా ఎక్కువ ఎరువులు కేంద్ర ప్రభుత్వం తెలంగాణాకి సరఫరా చేసింది తెలంగాణాలో అవసరానికి సరిపడా ఎరువులకన్నా ఎక్కువ ఎరువులు కేంద్ర ప్రభుత్వం తెలంగాణాకి సరఫరా చేసింది.. ప్రధాని నరేంద్ర మోదీ గారిపై, బిజెపిపై బురదజల్లేందుకే కొంతమంది కావాలని కృత్రిమంగా ఎరువుల కొరత సృష్టిస్తున్నారు! - శ్రీ కిషన్ రెడ్డి గారు, కేంద్ర మంత్రివర్యులు, బిజెపి రాష్ట్ర అధ్యక్షులు Subscribe Now: https://www.youtube.com/BJP4Telangana Stay Updated! 🔔 Follow us to stay updated: ► Like us on Facebook: https://www.facebook.com/BJP4Telangana ► Follow us on Twitter: https://twitter.com/BJP4Telangana ► Follow us on Instagram: https://www.instagram.com/bjp4telangana/

English · AI translation

The central government supplied more fertilizer to Telangana than was needed. The central government supplied more fertilizer to Telangana than was needed. Some people are deliberately creating an artificial fertilizer shortage just to smear Prime Minister Narendra Modi and the BJP! - Shri Kishan Reddy, Union Minister, BJP state president

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The central government supplied more fertilizer to Telangana than was required.” · confidence 94%

Sentiment: mixedStance toward government: supportiveTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3001ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 6b50517a · raw item feb8b247 · origin live

YouTubeMega9TV TelanganaMedia organisation94%22 Feb, 18:57 IST
Nirmal (99% conf.)Telugustance: critical10 views · 1 likes · 0 comments
Was live

ఎరువులు అందక గోస పడుతున్నం..! | Nirmal | CM Revanth Reddy | Mega9 Telangana

Original — Telugu

ఎరువులు అందక గోస పడుతున్నం..! | Nirmal | CM Revanth Reddy | Mega9 Telangana

Show full source text as published

ఎరువులు అందక గోస పడుతున్నం..! | Nirmal | CM Revanth Reddy | Mega9 Telangana ఎరువులు అందక గోస పడుతున్నం..! | Nirmal | CM Revanth Reddy | Mega9 Telangana #mega9telangana #cmrevanthreddy #nirmal #telangana #telangananews

English · AI translation

We are suffering because fertilizers are not being supplied..! | Nirmal | CM Revanth Reddy | Mega9 Telangana

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are not receiving fertilizers.” · confidence 94%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3408ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 9f5b5649 · raw item 980c38d7 · origin live

YouTubeETV TelanganaMedia organisation96%6 Feb, 11:49 IST
Hanumakonda · Shayampet (97% conf.)Telugustance: critical596 views · 8 likes · 0 comments

Famers Protest at Private Fertilizer Shop | Hanumakonda |ప్రైవేట్ ఫర్టిలైజర్ దుకాణం ఎదుట రైతుల నిరసన

Original — Telugu

హనుమకొండ జిల్లా శాయంపేటలో ఓ పురుగుమందుల దుకాణం ఎదుట రైతులు నిరసన చేపట్టారు. ఓ ప్రైవేట్ ఫర్టిలైజర్ దుకాణంలో.......గడ్డి నివారణకు పలువురు రైతులు గడ్డి మందు కొనుగోలు చేశారు. గడ్డి మందును మెుక్కజొన్న చేనుపై పిచికారి చేయగా....గడ్డితో పాటు మెుక్కజొన్న చేను కూడా పూర్తిగా ఎండిపోయింది. ఈ విషయాన్ని షాపు యజమాని దృష్టికి తీసుకెళ్లగా....నిర్లక్ష్యంగా వ్యవహరిస్తూ ఇష్టం వచ్చిన చోట చెప్పుకోమని దురుసుగా ప్రవర్తించాడని రైతులు ఆవేదన వ్యక్తం చేశారు. యజమాని లైసెన్స్ రద్దు చేసి కఠిన చర్యలు తీసుకోవాలని రైతులు డిమాండ్ చేస్తున్నారు. ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. For More Latest Political and News Updates :

Show full source text as published

Famers Protest at Private Fertilizer Shop | Hanumakonda |ప్రైవేట్ ఫర్టిలైజర్ దుకాణం ఎదుట రైతుల నిరసన హనుమకొండ జిల్లా శాయంపేటలో ఓ పురుగుమందుల దుకాణం ఎదుట రైతులు నిరసన చేపట్టారు. ఓ ప్రైవేట్ ఫర్టిలైజర్ దుకాణంలో.......గడ్డి నివారణకు పలువురు రైతులు గడ్డి మందు కొనుగోలు చేశారు. గడ్డి మందును మెుక్కజొన్న చేనుపై పిచికారి చేయగా....గడ్డితో పాటు మెుక్కజొన్న చేను కూడా పూర్తిగా ఎండిపోయింది. ఈ విషయాన్ని షాపు యజమాని దృష్టికి తీసుకెళ్లగా....నిర్లక్ష్యంగా వ్యవహరిస్తూ ఇష్టం వచ్చిన చోట చెప్పుకోమని దురుసుగా ప్రవర్తించాడని రైతులు ఆవేదన వ్యక్తం చేశారు. యజమాని లైసెన్స్ రద్దు చేసి కఠిన చర్యలు తీసుకోవాలని రైతులు డిమాండ్ చేస్తున్నారు. ------------------------------------------------------------------------------------------------------------- #latestnewstelugutoday #etvtelanganalive #latestnewsupdate ETV Telangana has been at the forefront of Producing reliable and important news stories which happens around the globe to its viewers. WATCH ETV TELANGANA LIVE HERE: https://tinyurl.com/uvbvdx9x For More Latest Political and News Updates : SUBSCRIBE ► ETV Telangana : https://shorturl.at/lK94S #etvtelanganalive #BreakingNews #TrendingNews #LiveUpdates #LatestNews #ViralNews ETV Telangana Live is a 24/7 Telugu news television channel in Telangana and is a part of ETV Network dedicated to the Latest Political News, Live Reports, Exclusive Interviews, Breaking News, Sports News, Weather Updates, Entertainment, Business, and Current Affairs. ► Watch LIVE: https://bit.ly/3Orz2jn ► For Latest News : http://www.ts.etv.co.in ► Follow us on WhatsApp: https://whatsapp.com/channel/0029Va8RS5O2ER6coKrig41U ► Follow us on X : https://twitter.com/etvtelangana ► Follow us on Instagram : https://www.instagram.com/etvtelangana ► Subscribe to ETV Telangana : https://bit.ly/4ihMVyy ► Like us on Facebook: https://www.facebook.com/ETVTelangana ► Follow us on Threads: https://www.threads.net/@etvandhrapradesh ► ETV Telangana News App : https://f66tr.app.goo.gl/apps ►ETV Win Website : https://www.etvwin.com/ #etvtelangana #etvtelanganalive #EtvTelanganaNews #livenews #latestnews #etvandhrapradeshlive #TeluguNews #latestnews #latestnewstoday #latestnewsupdate #latestnewstelugutoday #latestnewstelugu

English · AI translation

Farmers staged a protest in front of a pesticide shop in Shayampet of Hanumakonda district. At a private fertilizer shop, several farmers bought weed killer for weed control. When the weed killer was sprayed on a maize field, not only the weeds but the maize crop also completely dried up. When they brought this to the shop owner's notice, farmers said he behaved rudely, acted negligently, and told them to complain wherever they wanted. Farmers are demanding that the owner's license be cancelled and strict action be taken.

input-costcrop-damagefertilizer-availabilitypest-outbreakmaize
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers protested in Shayampet, Hanumakonda district, after a weedicide used on maize fields allegedly caused the maize crop to dry up completely.” · confidence 95%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2380ms)

Processing trail
  1. NORMALIZED · 9 Sept, 22:34
  2. RELEVANCE_ACCEPTED · 9 Sept, 22:36
  3. ENRICHED · 9 Sept, 22:38
  4. DEDUPED · 9 Sept, 22:39
  5. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  6. NARRATIVE_ASSIGNED · 9 Sept, 22:40
  7. NARRATIVE_ASSIGNED · 9 Sept, 22:41
  8. NARRATIVE_ASSIGNED · 9 Sept, 22:41
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:14
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 16:45
  12. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  13. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  14. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  15. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  16. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  17. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  18. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  19. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  20. NARRATIVE_ASSIGNED · 16 Sept, 19:58
  21. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  22. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  23. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  24. NARRATIVE_ASSIGNED · 17 Sept, 21:02
  25. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  26. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  27. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  28. NARRATIVE_ASSIGNED · 20 Sept, 19:45
  29. NARRATIVE_ASSIGNED · 20 Sept, 23:13
  30. NARRATIVE_ASSIGNED · 21 Sept, 01:29
  31. NARRATIVE_ASSIGNED · 21 Sept, 11:16
  32. NARRATIVE_ASSIGNED · 21 Sept, 22:41
  33. NARRATIVE_ASSIGNED · 22 Sept, 05:32

mention 78486ba2 · raw item c2f0a21a · origin live

YouTubeI Am NithinCreator82%24 Jan, 18:14 IST
Rajanna Sircilla · vemulawada (94% conf.)Englishstance: neutral264 views · 13 likes · 0 comments

Srilatha fertilizers opposite on municipal office, vemulawada, Sircilla district #fertilizer #ganga

Original — English

Srilatha fertilizers opposite on municipal office, vemulawada, Sircilla district

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Srilatha Fertilizers is opposite the municipal office in Vemulawada, Sircilla district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 90%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2348ms)

Processing trail
  1. NORMALIZED · 11 Sept, 01:56
  2. RELEVANCE_ACCEPTED · 11 Sept, 01:57
  3. ENRICHED · 11 Sept, 01:59
  4. DEDUPED · 11 Sept, 02:01
  5. NARRATIVE_ASSIGNED · 11 Sept, 02:02
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention abe46820 · raw item 5b96461a · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%31 Dec, 13:28 IST
District not evidencedEnglishstance: supportive104 views · 1 likes · 1 reposts · 1 comments
Original — English

Boost your paddy yield with IFFCO Nano DAP🌟 Here's a clear difference: Paddy seeds treated with IFFCO Nano DAP show superior growth compared to the untreated seed🌾

Show full source text as published

Boost your paddy yield with IFFCO Nano DAP🌟 Here's a clear difference: Paddy seeds treated with IFFCO Nano DAP show superior growth compared to the untreated seed🌾 ✅More nutrients ✅Healthier crops 📸Witness the results yourself @drusawasthi @iffcoyogendra @IFFCO_PR https://t.co/I92f7iPbrl

fertilizer-availabilityseedsfarm-mechanisationpaddy
Open original source ↗
AI interpretation & provenance
Extracted claim

“Paddy seeds treated with IFFCO Nano DAP show superior growth compared with untreated seed.” · confidence 90%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 70%Agriculture relevance: 100%Classification confidence: 87%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1763ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:23
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:40
  3. ENRICHED · 29 Aug, 23:43
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:26
  6. ENRICHED · 8 Sept, 01:34
  7. DEDUPED · 8 Sept, 02:08
  8. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  9. NARRATIVE_ASSIGNED · 8 Sept, 02:20
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  12. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  14. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  15. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  16. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  17. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  18. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  19. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  20. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  21. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  22. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  23. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 36ee5d76 · raw item 2c969cdc · origin live

YouTubewarangal _ganiDealer74%20 Dec, 07:55 IST
Warangal (90% conf.)Telugustance: neutral92 views · 3 likes · 0 comments

సెల్:7799095993 అన్ని రకాల విత్తనాలు,ఎరువులు .#warangal #viralvideos #farmerlife #telangana

Original — Telugu

సెల్:7799095993 అన్ని రకాల విత్తనాలు,ఎరువులు .#warangal

English · AI translation

Cell: 7799095993 all kinds of seeds, fertilizers. #warangal #viralvideos #farmerlife #telangana Cell: 7799095993 all kinds of seeds, fertilizers. #warangal

seedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The post provides a mobile number for all kinds of seeds and fertilizers.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 96%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1493ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  12. NARRATIVE_ASSIGNED · 20 Sept, 05:57

mention 06cb46f3 · raw item c15341c8 · origin live

YouTubeT News teluguMedia organisation96%21 Oct, 20:00 IST
Nirmal (98% conf.)Englishstance: neutral310 views · 1 likes · 0 comments
Was live

Farmers QueLine For Fertilizer At Nirmal District | ఎరువుల కోసం లైన్ లో చెప్పులు | T News

Original — English

Farmers QueLine For Fertilizer At Nirmal District | ఎరువుల కోసం లైన్ లో చెప్పులు | T News

Show full source text as published

Farmers QueLine For Fertilizer At Nirmal District | ఎరువుల కోసం లైన్ లో చెప్పులు | T News Welcome to T News Live. First Telugu News channel in Telangana, T News Live provides 24/7 coverage of breaking news, live updates, and exclusive interviews. Stay informed with the latest political developments, including updates from BRS (Bharath Rashtra Samithi), Congress & BJP Parties. Our diverse programming features engaging content such as political debates like Varthalu Vastavalu, sports news, weather updates, entertainment highlights, and business news. Join us for comprehensive coverage that keeps you connected with the heartbeat of Telangana. Subscribe to T News Telugu for the latest news and updates. ✔️ Subscribe : https://bit.ly/3TUVpOL 🔴 LIVE Stream : https://bit.ly/3NjBKHh ✔️ WhatsApp Channel : https://shorturl.at/tFWX7 #Tnews #TnewsLive #TnewsTelugu Facebook : https://www.facebook.com/tnewstelugu Instagram : https://www.instagram.com/tnewstelugu Twitter : https://twitter.com/tnewstelugu WhatsApp : https://bit.ly/3oTbYNY Website : https://tnewstelugu.com -----*****-----

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are standing in line for fertilizer in Nirmal district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 99%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1557ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 022e4656 · raw item 89fe9d8f · origin live

YouTubeSiri walaCreator74%14 Oct, 12:28 IST
Mahabubnagar · devarakadra (83% conf.)Telugustance: neutral1,190 views · 52 likes · 27 comments
Was live

ఏ మందు... #village #agriculture #fertilizer #mahabubnagar #devarakadrabullsmarket #telangana #funny

Original — Telugu

Village vlog... @JDSwala @Siriwala

Show full source text as published

ఏ మందు... #village #agriculture #fertilizer #mahabubnagar #devarakadrabullsmarket #telangana #funny Village vlog... @JDSwala @Siriwala #agriculture #fertilizer #mahabubnagar #devarakadra #telangana

English · AI translation

What medicine... #village #agriculture #fertilizer #mahabubnagar #devarakadrabullsmarket #telangana #funny Village vlog... @JDSwala @Siriwala

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content mentions fertilizer and Mahabubnagar.” · confidence 91%

Sentiment: neutralStance toward government: neutralTelangana relevance: 70%Agriculture relevance: 80%Classification confidence: 78%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2197ms)

Processing trail
  1. NORMALIZED · 10 Sept, 15:30
  2. RELEVANCE_ACCEPTED · 10 Sept, 15:32
  3. ENRICHED · 10 Sept, 15:33
  4. DEDUPED · 10 Sept, 15:36
  5. NARRATIVE_ASSIGNED · 10 Sept, 15:37
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention d60f9150 · raw item 2c2ab9bd · origin live

YouTubeBIG TV KhammamMedia organisation94%6 Aug, 15:15 IST
Khammam (98% conf.)Telugustance: neutral2,362 views · 4 likes · 1 comments

రైతులకు ఎరువులు పంపిణీ | Thummala Nageswara Rao | BIG TV Khammam

Original — Telugu

రైతులకు ఎరువులు పంపిణీ | Thummala Nageswara Rao | BIG TV Khammam

Show full source text as published

రైతులకు ఎరువులు పంపిణీ | Thummala Nageswara Rao | BIG TV Khammam రైతులకు ఎరువులు పంపిణీ | Thummala Nageswara Rao | BIG TV Khammam #thummalanageswararao #fertilizer #farmers #khammam #bigtv 🔔 Subscribe to our channel ✅ Stay Connected to Us. 👉 Website: https://www.bigtvlive.com/ 👉 Facebook: https://www.facebook.com/bigtvlive 👉 Twitter: https://twitter.com/bigtvtelugu 👉 WhatsApp: https://whatsapp.com/channel/0029VaAe49e72WTw8YM6zr3q 👉 Instagram: https://www.instagram.com/big_tv_live/ BigTV It Is A Technology First 24/7 LIVE Telugu Satellite News Channel. Watch BigTV For Exclusive News Stories, Breaking News, Political News, Exclusive Interviews, Entertainment Updates, Press Meets, Devotional Updates, Sports Updates, Live Updates, Debates And Discussions.

English · AI translation

Fertilizer distribution to farmers | Thummala Nageswara Rao | BIG TV Khammam

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizers are being distributed to farmers.” · confidence 87%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 92%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1967ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 61a5b6b0 · raw item 7fa8c658 · origin live

YouTubePublic TV NewsMedia organisation99%15 Jun, 16:30 IST
Mulugu (98% conf.)Telugustance: neutral42 views · 0 likes · 0 comments

ములుగు లోని ఇంచేర్ల గ్రామంలో ప్రాథమిక వ్యవసాయ సహవార సంఘం ఎరువుల గోదాంను ప్రారంభించిన మంత్రి సీతక్క.

Original — Telugu

Public TV Bharat 24X7 NEWS

English · AI translation

Minister Seethakka inaugurated the fertilizer warehouse of the primary agricultural cooperative society in Incherla village of Mulugu. Public TV Bharat 24X7 NEWS

fertilizer-availabilitycooperative
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Minister Seethakka inaugurated a primary agricultural cooperative society fertilizer warehouse in Incherla village, Mulugu.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2458ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention cc986b3f · raw item c89b7b3c · origin live

YouTubeTODAYTV TELUGUMedia organisation97%30 May, 19:04 IST
Sangareddy (98% conf.)Telugustance: critical2 views · 0 likes · 0 comments

#sangareddy కరీఫ్ లో రైతులకు అవసరమైన ఎరువులు, విత్తనాలు అందుబాటులో ఉంచాలి- చింత ప్రభాకర్

Original — Telugu

Join this channel to get access to perks:

Show full source text as published

#sangareddy కరీఫ్ లో రైతులకు అవసరమైన ఎరువులు, విత్తనాలు అందుబాటులో ఉంచాలి- చింత ప్రభాకర్ Join this channel to get access to perks: https://www.youtube.com/channel/UCwMzLtr5mMIiA9MEnqR7hyg/join TODAY TV Channel is the popular Telugu News channel Across Telangana and Andhra Pradesh. Telugu Live news gives 24 Hours live news covering political news, sports news, entertainment news, facebook live events, comedy Telugu web series and Tollywood movie promotions, Free Telugu News Channel, 24/7 news Telugu channel News Covered from Vijayawada, Guntur, Hyderabad, Vizag, Amaravathi, Warangal, Khammam, Srikakulam, Nellore, Prakasam, Ananthapur.... All Telugu Districts

English · AI translation

#Sangareddy Fertilizers and seeds required by farmers during the kharif season should be made available - Chinta Prabhakar Fertilizers and seeds required by farmers during kharif should be made available, said MLA Chinta Prabhakar. Before the start of the monsoon season agricultural work, Rythu Bharosa funds should be released in June at the rate of 7,500 per acre. Just as people were made to stand in lines for fertilizers and seeds in the संयुक्त state, now under Congress rule there is a situation where people are again made to stand in lines for passbooks. Agriculture department officials should be alert about fake seeds. If fake seeds are supplied, cases should be registered under the PD Act. Farmers should be made aware of fake seeds. Steps should be taken to provide fertilizers and seeds to farmers at subsidized rates and to provide loans through banks. Mango farmers who suffered losses due to hailstorm and farmers whose paddy grain got wet should be supported by giving compensation.

fertilizer-availabilityseedsfarmer-support-schemescrop-damagefake-seedsrythu-bharosa-paymentmangopaddyrythu-bharosa
Open original source ↗
AI interpretation & provenance
Extracted claim

“The content says that in Sangareddy, farmers' required fertilizers and seeds should be made available during the kharif season, and Rythu Bharosa funds should be released in June.” · confidence 92%

Sentiment: neutralStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3167ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  8. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 17 Sept, 21:02
  11. NARRATIVE_ASSIGNED · 17 Sept, 21:03
  12. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  13. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  14. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  15. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  16. NARRATIVE_ASSIGNED · 20 Sept, 19:45
  17. NARRATIVE_ASSIGNED · 20 Sept, 23:13
  18. NARRATIVE_ASSIGNED · 21 Sept, 01:29
  19. NARRATIVE_ASSIGNED · 21 Sept, 11:16
  20. NARRATIVE_ASSIGNED · 21 Sept, 22:42
  21. NARRATIVE_ASSIGNED · 22 Sept, 05:33

mention 1f8825d1 · raw item 85eacc85 · origin live

YouTubePrime9 NewsMedia organisation98%30 May, 12:48 IST
Komaram Bheem Asifabad (93% conf.)Telugustance: neutral149 views · 1 likes · 0 comments

ఎరువులు షాప్ లో కలెక్టర్ ఆకస్మిక తనిఖీలు | Asifabad | Prime9 News

Original — Telugu

ఎరువులు షాప్ లో కలెక్టర్ ఆకస్మిక తనిఖీలు | Asifabad | Prime9 News

Show full source text as published

ఎరువులు షాప్ లో కలెక్టర్ ఆకస్మిక తనిఖీలు | Asifabad | Prime9 News #seeds #shop #cheking #collector #asifabad #prime9news ఎరువులు షాప్ లో కలెక్టర్ ఆకస్మిక తనిఖీలు | Asifabad | Prime9 News Kindly subscribe.. Prime9News - https://www.youtube.com/Prime9News/videos Prime9 Digital - https://www.youtube.com/@Prime9NewsLiveTelugu WATCH LIVE - https://youtu.be/4PpS_RGUzfQ Follow Prime9 News.. Prime9 Website - https://prime9news.com/ Prime9 Facebook - https://www.facebook.com/prime9news Prime9 Twitter - https://twitter.com/prime9news Prime9 Instagram - https://www.instagram.com/prime9news/

English · AI translation

Surprise inspections were conducted by the district collector Venkatesh Dothre at fertilizer and seed shops in the district headquarters. He examined the transaction records being maintained in the shops and collected details of the stock available with the dealers. The collector suggested that efforts should be made to ensure that seeds reach every farmer. He warned that cases would be registered if they were sold at a price higher than the MRP. He said that not only the cotton seeds in demand but also other seeds should be kept available. District Collector Venkatesh Dothre explained that if the details of items with low stocks are provided to the authorities, they will be taken to the government’s attention and action will be taken so that seeds and fertilizers are supplied to farmers on time.

seedsfertilizer-availabilityinput-costseed-availabilitycotton
Open original source ↗
AI interpretation & provenance
Extracted claim

“The district collector conducted surprise inspections at fertilizer and seed shops in the district headquarters and warned that cases would be filed if prices were charged above MRP.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3861ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:40
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  7. NARRATIVE_ASSIGNED · 16 Sept, 14:45
  8. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  9. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  10. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  11. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  12. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  14. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 14130830 · raw item 7ae3f316 · origin live

YouTubePraja Sarkar NewsMedia organisation96%28 May, 22:04 IST
Kamareddy (99% conf.)Englishstance: neutral13 views · 0 likes · 0 comments

Farmers are queuing for seeds and fertilizers from 4 am at Gandhi Ganji, Kamareddy

Original — English

Farmers are queuing for seeds and fertilizers from 4 am at Gandhi Ganji, Kamareddy

Show full source text as published

Farmers are queuing for seeds and fertilizers from 4 am at Gandhi Ganji, Kamareddy Farmers are queuing for seeds and fertilizers from 4 am at Gandhi Ganji, Kamareddy #brsktr #brsharishrao #congress #kamareddy  #inctelangana #indiannationalcongress #congresstelangana #bjpmodi #bjpbandisanjay #prajasarkarnews #prajasarkar1minnews

seedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are queuing for seeds and fertilizers from 4 am at Gandhi Ganji, Kamareddy.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 99%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2208ms)

Processing trail
  1. NORMALIZED · 10 Sept, 05:56
  2. RELEVANCE_ACCEPTED · 10 Sept, 05:56
  3. ENRICHED · 10 Sept, 05:57
  4. DEDUPED · 10 Sept, 05:57
  5. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  6. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  20. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 5cb946de · raw item 8e7d0042 · origin live

YouTubeinews teluguMedia organisation97%27 May, 21:08 IST
Kamareddy (99% conf.)Telugustance: critical126 views · 0 likes · 0 comments
Was live

కామారెడ్డి లో ఎరువుల కొరత ..రైతుల ఆవేదన | Farmers Q Line For Fertilizers At Kamareddy | iNews

Original — Telugu

కామారెడ్డి లో ఎరువుల కొరత ..రైతుల ఆవేదన | Farmers Q Line For Fertilizers At Kamareddy | iNews

Show full source text as published

కామారెడ్డి లో ఎరువుల కొరత ..రైతుల ఆవేదన | Farmers Q Line For Fertilizers At Kamareddy | iNews #kamareddy #farmerprotest #inews #inewstelugu కామారెడ్డి లో ఎరువుల కొరత ..రైతుల ఆవేదన | Farmers Q Line For Fertilizers At Kamareddy | iNews ► Like us on Facebook :https://www.facebook.com/INews ► Follow us on Instagram : https://www.instagram.com/inewsofficial ► Follow us on Twitter : https://twitter.com/inewstelugu ► Follow us on Official Site : https://inewstelugu.com/

English · AI translation

Fertilizer shortage in Kamareddy .. farmers’ distress | Farmers Q Line For Fertilizers At Kamareddy | iNews

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a fertilizer shortage in Kamareddy and farmers are expressing distress.” · confidence 98%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1800ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 7a87198f · raw item b6d09933 · origin live

YouTubeZee Telugu NewsMedia organisation99%27 May, 21:04 IST
Jagtial (97% conf.)Telugu / Englishstance: neutral207 views · 1 likes · 1 comments
Was live

Farmers Q Line For Seeds At Jagityal | పచ్చిరొట్టె ఎరువుల కోసం రైతుల క్యూ | ZEE Telugu News

Original — Telugu / English

Zee Media Corporation Limited (formerly Zee News Ltd.), part of multibillion-dollar Essel Group, is India's one of the largest News networks with 14 news channels. Zee News and Zee Hindustan (National News Channels Hindi) are part of ZMCL. Zee Telugu News is the latest offering from Zee Media Corporation umbrella. Zee Telugu News brings you comprehensive and unbiased news coverage on social, political issues along with entertainment programs from Andhra Pradesh & Telangana (Telugu states), India and worldwide. For all-inclusive news coverage please follow Zee Telugu News content across all platforms. Breaking News Telugu | World News Telugu | National News Telugu

Show full source text as published

Farmers Q Line For Seeds At Jagityal | పచ్చిరొట్టె ఎరువుల కోసం రైతుల క్యూ | ZEE Telugu News Farmers Q Line For Seeds At Jagityal | పచ్చిరొట్టె ఎరువుల కోసం రైతుల క్యూ | ZEE Telugu News #jagityal #farmers #seeds Zee Media Corporation Limited (formerly Zee News Ltd.), part of multibillion-dollar Essel Group, is India's one of the largest News networks with 14 news channels. Zee News and Zee Hindustan (National News Channels Hindi) are part of ZMCL. Zee Telugu News is the latest offering from Zee Media Corporation umbrella. Zee Telugu News brings you comprehensive and unbiased news coverage on social, political issues along with entertainment programs from Andhra Pradesh & Telangana (Telugu states), India and worldwide. For all-inclusive news coverage please follow Zee Telugu News content across all platforms. #ZeeNewsTelugu #TeluguNews #ZeeHindustanTelugu Breaking News Telugu | World News Telugu | National News Telugu Follow Us: Zee Telugu News Youtube https://www.youtube.com/channel/UCfWo0Z5PKYd86JfQ5ZE5cWg Zee TeluguNews Facebook https://www.facebook.com/ZeeTeluguNews/ Zee Telugu News Twitter https://twitter.com/ZeeTeluguLive Zee Telugu News Instagram https://www.instagram.com/zeetelugunews/ Zee Telugu News Telegram t.me/zeetelugunews Zee Telugu News Whatapps https://whatsapp.com/channel/0029VaAWII35fM5eZIzUbB2B Download ZEE App - https://bit.ly/3kAPe3Y ☛ Visit our website: https://zeenews.india.com/telugu Zee Telugu News Website https://zeenews.india.com/telugu

English · AI translation

Farmers Q Line For Seeds At Jagityal | Farmers queue for green manure fertilizers | ZEE Telugu News Zee Media Corporation Limited (formerly Zee News Ltd.), part of multibillion-dollar Essel Group, is India's one of the largest News networks with 14 news channels. Zee News and Zee Hindustan (National News Channels Hindi) are part of ZMCL. Zee Telugu News is the latest offering from Zee Media Corporation umbrella. Zee Telugu News brings you comprehensive and unbiased news coverage on social, political issues along with entertainment programs from Andhra Pradesh & Telangana (Telugu states), India and worldwide. For all-inclusive news coverage please follow Zee Telugu News content across all platforms. Breaking News Telugu | World News Telugu | National News Telugu

seedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers lined up for seeds at Jagtial.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2595ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention c5bf566b · raw item a95c239e · origin live

YouTubeANN TeluguMedia organisation87%27 May, 19:21 IST
Kamareddy (99% conf.)Telugu / Englishstance: neutral24 views · 0 likes · 0 comments

Kamareddy :ఎరువుల కోసం క్యూలైన్లో బారులు తీరిన రైతులు ..|Farmers lined up in queues for fertilisers

Original — Telugu / English

For more latest updates on the news : ► FacebookGroup :

Show full source text as published

Kamareddy :ఎరువుల కోసం క్యూలైన్లో బారులు తీరిన రైతులు ..|Farmers lined up in queues for fertilisers #kamareddy #fertilisers #farmersprotest #telangananews #ammanews Kamareddy :ఎరువుల కోసం క్యూలైన్లో బారులు తీరిన రైతులు ..|Farmers lined up in queues for fertilisers You are Watching Amma News Live. It is a leading Telugu News Channel, bringing you the first account of all the latest news online from around the world including breaking news, regional news, national news, international news, sports updates, entertainment gossips, political news, crime reports. If you like this video, please don’t forget to subscribe and like, comment the Amma News Live for more interesting updates and Trending Public videos. #AMMANEWSLIVE #AMMANEWS #AMMATeluguLive #AMMATelugu #AMMANEWSLIVETELUGU #AMMATeluguLIVE #AMMANEWSLIVE #BreakingNews #FlashNews #SpeedNews #TeluguNews For more latest updates on the news : ► Subscribe to Amma News Channel: https://www.youtube.com/c/Ammanewslivev ► Like us on Facebook: https: https://www.facebook.com/Ammanewslive/ ► Follow us on Twitter : https://twitter.com/ammanews1 ► ShareChat : https://sharechat.com/profile/ammanewslive?referrer=copyLink ► FacebookGroup : https://www.facebook.com/groups/1813851678807723 ► Instagram : https://instagram.com/ammanewslive11?utm_medium=copy_link ► Koo APP https://www.kooapp.com/profile/AmmaNewsLive #Telangananews #Hyderabadnews #Adilabadnews #ammanews #AmmaNews #AmmaNewsLive #AmmaNewsHD #AmmaNewsChannel #TelanganaNews #APNews #AndhraPradeshNews #TeluguLiveUpdates #TeluguNewsLive #TeluguLive #LiveTV #TeluguNews #Telugunewslive #TeluguLive #TeluguNews #latesttelugunews #TeluguNewsChannel #LatestNews #telugu #TeluguBreakingNews #TSnews #TelanganaNews #TelanganaNews #AndhrapradeshNews #HyderabadNews #politicalnews #telanganapolitics

English · AI translation

Kamareddy: Farmers lined up in queues for fertilizers. | Farmers lined up in queues for fertilizers

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers lined up in queues for fertilisers in Kamareddy.” · confidence 98%

Sentiment: negativeStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 92%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1842ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention fe7e6b9f · raw item c2cbf15c · origin live

YouTubePrime9 NewsMedia organisation98%27 May, 14:25 IST
Kamareddy (98% conf.)Telugustance: neutral87 views · 0 likes · 0 comments

రైతులకు సరిపడా ఎరువులు అందకపోవడంతో ఆగ్రహం | Kamareddy District | Prime9 News

Original — Telugu

రైతులకు సరిపడా ఎరువులు అందకపోవడంతో ఆగ్రహం | Kamareddy District | Prime9 News#prime9news Follow Prime9 News..

Show full source text as published

రైతులకు సరిపడా ఎరువులు అందకపోవడంతో ఆగ్రహం | Kamareddy District | Prime9 News #kamareddy #farmers #telangananews #prime9news రైతులకు సరిపడా ఎరువులు అందకపోవడంతో ఆగ్రహం | Kamareddy District | Prime9 News#prime9news #prime9newslive #prime9newstelugu Kindly subscribe.. Prime9News - https://www.youtube.com/@Prime9News Prime9 Digital - https://www.youtube.com/channel/UCRzY... Follow Prime9 News.. Prime9 Website - https://prime9news.com/ Prime9 Facebook - https://www.facebook.com/prime9news Prime9 Twitter - https://twitter.com/prime9news ----*****----

English · AI translation

Farmers are angry because they are not getting enough fertilizers | Kamareddy District | Prime9 News Farmers are angry because they are not getting enough fertilizers | Kamareddy District | Prime9 News#prime9news Follow Prime9 News..

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are angry because they are not receiving enough fertilizers.” · confidence 95%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2104ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 2c748a46 · raw item adc0e78a · origin live

YouTubeNTV TeluguMedia organisation99%27 May, 11:51 IST
Kamareddy (99% conf.)Telugu / Englishstance: neutral397 views · 1 likes · 0 comments

కామారెడ్డిలో ఎరువుల కోసం రోడ్డెక్కిన రైతులు | Kamareddy | Ntv

Original — Telugu / English

For more latest updates on the news : Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV.

Show full source text as published

కామారెడ్డిలో ఎరువుల కోసం రోడ్డెక్కిన రైతులు | Kamareddy | Ntv కామారెడ్డిలో ఎరువుల కోసం రోడ్డెక్కిన రైతులు | Kamareddy | Ntv #kamareddy #fertilizer #ntv For more latest updates on the news : ► Visit Our Website : https://ntvtelugu.com/ ► Subscribe to NTV News Channel: http://goo.gl/75PJ6m ► Like us on Facebook: https://www.facebook.com/NtvTeluguLive/ ► Follow us on Twitter At https://twitter.com/ntvtelugulive Watch NTV Telugu News Channel, popular Telugu News channel which also owns India's first women's channel Vanitha TV, and India's most popular devotional channel Bhakti TV. #ntv #ntvtelugu #ntvlive #ntvnews #andhrapradeshelection2024 #LokSabhaElections2024 #ElectionsonNTV #apresults2024 #resultsday #apelectionresults #apresults2024

English · AI translation

Farmers took to the road in Kamareddy for fertilizers | Kamareddy | NTV

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Kamareddy took to the road demanding fertilizers.” · confidence 96%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1429ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 4e563c1b · raw item b16b2a63 · origin live

YouTubehmtv Telugu NewsMedia organisation99%27 May, 11:40 IST
Kamareddy (99% conf.)Telugu / Englishstance: neutral716 views · 4 likes · 0 comments

కామారెడ్డి జిల్లాలో ఎరువుల కోసం ఎగబడ్డ రైతులు | Farmers Q Line For Fertilizers At Kamareddy | hmtv

Original — Telugu / English

కామారెడ్డి జిల్లాలో ఎరువుల కోసం ఎగబడ్డ రైతులు | Farmers Q Line For Fertilizers At Kamareddy | hmtv

Show full source text as published

కామారెడ్డి జిల్లాలో ఎరువుల కోసం ఎగబడ్డ రైతులు | Farmers Q Line For Fertilizers At Kamareddy | hmtv కామారెడ్డి జిల్లాలో ఎరువుల కోసం ఎగబడ్డ రైతులు | Farmers Q Line For Fertilizers At Kamareddy | hmtv #kamareddy #farmers #hmtv ► Watch hmtv Live : https://www.youtube.com/watch?v=2fvNaWiBUPU ► Subscribe to hmtv News YouTube : http://goo.gl/f9lm5E ► Like us on FB : https://www.facebook.com/hmtvnewslive ► Follow us on Twitter : https://twitter.com/hmtvnewslive ► Instagram : https://www.instagram.com/hmtvnewsofficial/?hl=en ►Telegram : https://t.me/hmtvnewslive ► For News in Telugu: http://www.hmtvlive.com/ ► For News in English: http://www.thehansindia.com

English · AI translation

Farmers in Kamareddy district rushed for fertilizers | Farmers Q Line For Fertilizers At Kamareddy | hmtv

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Kamareddy district lined up for fertilizers.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 99%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1966ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:41
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 5f346061 · raw item 35a7cb71 · origin live

YouTubeTV9 Telugu LiveMedia organisation99%27 May, 11:23 IST
Kamareddy (98% conf.)Telugustance: neutral594 views · 6 likes · 0 comments

Kamareddy : ఎరువుల కోసం రైతుల బారులు - TV9

Original — Telugu

Kamareddy : ఎరువుల కోసం రైతుల బారులు - TV9

Show full source text as published

Kamareddy : ఎరువుల కోసం రైతుల బారులు - TV9 Kamareddy : ఎరువుల కోసం రైతుల బారులు - TV9 Watch LIVE: https://goo.gl/w3aQde తాజా వార్తల కోసం : https://tv9telugu.com/ ►TV9 LIVE : https://bit.ly/2FJGPps ►Subscribe to Tv9 Telugu Live: https://goo.gl/lAjMru ►Subscribe to Tv9 Entertainment Live: https://bit.ly/2Rg6nzL ►Big News Big Debate : https://bit.ly/2sjc9Iu ► Download Tv9 Android App: http://goo.gl/T1ZHNJ ► Download Tv9 IOS App: https://goo.gl/abC1bS ► Like us on Facebook: https://www.facebook.com/tv9telugu ► Follow us on Instagram: https://www.instagram.com/tv9telugu ► Follow us on Twitter: https://twitter.com/Tv9Telugu #Kamareddy #farmer #fertilizers #tv9telugu Credits : #VishwaGajagouni #TV9TSNewsUpdates

English · AI translation

Kamareddy: Farmers are standing in queues for fertilizers - TV9

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are standing in queues for fertilizers in Kamareddy.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1991ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention ec057d53 · raw item 0c3ed9f4 · origin live

YouTubeETV TelanganaMedia organisation96%25 May, 13:04 IST
Kamareddy (98% conf.)Telugustance: critical459 views · 4 likes · 0 comments

Farmers Q Line For Fertilizers At Kamareddy Dist | కామారెడ్డిలో ఎరువుల కోసం రైతుల బారులు

Original — Telugu

కామారెడ్డి జిల్లాలో రైతులు ఎరువుల కోసం వేకువజామున 5 గంటల నుంచే క్యూలో నిలబడుతున్నారు. ఎండను సైతం లెక్కచేయకుండా మధ్యాహ్నం వరకు పడిగాపులు కాస్తున్నారు. కొందరు రైతులు మండే ఎండకు తట్టుకోలేక వరుసలో కాగితాలు, రాళ్లను ఉంచుతున్నారు. ఒక పాసు పుస్తకానికి 30కిలోల జీలుగు విత్తనాలు మాత్రమే ఇస్తుండగా... 5 ఎకరాలకు పైగా భూమి ఉన్న రైతులు ఇబ్బందులు ఎదుర్కొంటున్నారు. ప్రభుత్వం, అధికారులు చొరవ తీసుకొని రైతులకు సరిపడా జీలుగు బస్తాలను.. పంపిణీ చేయాలని కోరుతున్నారు.

Show full source text as published

Farmers Q Line For Fertilizers At Kamareddy Dist | కామారెడ్డిలో ఎరువుల కోసం రైతుల బారులు కామారెడ్డి జిల్లాలో రైతులు ఎరువుల కోసం వేకువజామున 5 గంటల నుంచే క్యూలో నిలబడుతున్నారు. ఎండను సైతం లెక్కచేయకుండా మధ్యాహ్నం వరకు పడిగాపులు కాస్తున్నారు. కొందరు రైతులు మండే ఎండకు తట్టుకోలేక వరుసలో కాగితాలు, రాళ్లను ఉంచుతున్నారు. ఒక పాసు పుస్తకానికి 30కిలోల జీలుగు విత్తనాలు మాత్రమే ఇస్తుండగా... 5 ఎకరాలకు పైగా భూమి ఉన్న రైతులు ఇబ్బందులు ఎదుర్కొంటున్నారు. ప్రభుత్వం, అధికారులు చొరవ తీసుకొని రైతులకు సరిపడా జీలుగు బస్తాలను.. పంపిణీ చేయాలని కోరుతున్నారు. ------------------------------------------------------------------------------------------------------------- #etvtelangana #latestnews #newsoftheday #etvnews ------------------------------------------------------------------------------------------------------------- ☛ Follow ETV Telangana WhatsApp Channel : https://whatsapp.com/channel/0029Va8RS5O2ER6coKrig41U ☛ Download ETV Win App to Watch All ETV Channels for both Android & IOS: https://f66tr.app.goo.gl/apps ------------------------------------------------------------------------------------------------------------- For Latest Updates on ETV Telangana Channel !!! ☛ Follow Our WhatsApp Channel : https://whatsapp.com/channel/0029Va8RS5O2ER6coKrig41U ☛ Visit our Official Website: http://www.ts.etv.co.in ☛ Subscribe for Latest News - https://goo.gl/tEHPs7 ☛ Subscribe to our YouTube Channel : https://bit.ly/2UUIh3B ☛ Like us : https://www.facebook.com/ETVTelangana ☛ Follow us : https://twitter.com/etvtelangana ☛ Follow us : https://www.instagram.com/etvtelangana ☛ Etv Win Website : https://www.etvwin.com/ ------------------------------------------------------------------------------------------------------------

English · AI translation

Farmers are lining up for fertilizers in Kamareddy district from as early as 5 a.m. They are waiting until afternoon without regard for the sun. Some farmers, unable to bear the scorching heat, are placing papers and stones in the queue. While only 30 kg of jilegu seeds are being given per passbook, farmers with more than 5 acres of land are facing difficulties. They are requesting the government and officials to take initiative and distribute enough jilegu bags to farmers.

fertilizer-availabilityseedsseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers in Kamareddy district are lining up from 5 a.m. for fertilizers, and only 30 kg of jilegu seeds are being given per passbook.” · confidence 94%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2904ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  7. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention e46d4632 · raw item 3c77b03a · origin live

YouTube4SiDES TV TELUGUMedia organisation92%14 Apr, 18:40 IST
Kamareddy (96% conf.)Telugu / Englishstance: critical247 views · 1 likes · 0 comments

రైతుల నడ్డి విరుస్తున్న నకిలీ ఎరువులు, విత్తనాలు |Fake Seeds Fertilizers In Kamareddy@4SidesTvTelugu

Original — Telugu / English

Farmers who depend on agriculture for their livelihood are getting drowned in debt. The reason is that although the governments boast that the farmers are the king, the fake seeds and fertilizers are not being controlled, but the farmers are suffering severe losses. For More Latest Political and News Updates :

Show full source text as published

రైతుల నడ్డి విరుస్తున్న నకిలీ ఎరువులు, విత్తనాలు |Fake Seeds Fertilizers In Kamareddy@4SidesTvTelugu #farmers #agriculture #fertilizer #seeds #kamareddy #latestnews #telugunews #4sidestvtelugu Farmers who depend on agriculture for their livelihood are getting drowned in debt. The reason is that although the governments boast that the farmers are the king, the fake seeds and fertilizers are not being controlled, but the farmers are suffering severe losses. ---- తాజా వార్తల కోసం : https://foursidestv.com/ For More Latest Political and News Updates : ►Subscribe to 4Sides TV: https://www.youtube.com/@4SidesTvTelugu ►Follow us on Instagram: https://www.instagram.com/4sidestvtelugu ►Like us on Facebook: https://www.facebook.com/FourSidesTVTelugu/ ►Follow us on Twitter: https://twitter.com/4sidestvtelugu

English · AI translation

Fake fertilizers and seeds are breaking farmers’ backs | Fake Seeds Fertilizers In Kamareddy @4SidesTvTelugu Farmers who depend on agriculture for their livelihood are getting drowned in debt. The reason is that although the governments boast that the farmers are the king, the fake seeds and fertilizers are not being controlled, but the farmers are suffering severe losses. For More Latest Political and News Updates :

seedsfertilizer-availabilityinput-costfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fake seeds and fertilizers are not being controlled, and farmers are suffering severe losses.” · confidence 93%

Sentiment: negativeStance toward government: criticalTelangana relevance: 92%Agriculture relevance: 98%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2428ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  7. NARRATIVE_ASSIGNED · 16 Sept, 14:45
  8. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 432d1c59 · raw item e668ca19 · origin live

YouTubeMana Narayanpet Mana News MN Mana News Media organisation95%4 Aug, 18:32 IST
Narayanpet (98% conf.)Telugustance: neutral80 views · 2 likes · 0 comments

ఎరువులు కొనుగోలు చేసేందుకు రైతులు తప్పనిసరిగా ఆధార్‌కార్డులు తీసుకురావాలి #narayanpet #news #reels

Original — Telugu

ఎరువులు కొనుగోలు చేసేందుకు రైతులు తప్పనిసరిగా ఆధార్‌కార్డులు తీసుకురావాలి

English · AI translation

Farmers must compulsorily bring Aadhaar cards to purchase fertilizers. #narayanpet #news #reels Farmers must compulsorily bring Aadhaar cards to purchase fertilizers.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers must bring Aadhaar cards to purchase fertilizers.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 92%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1844ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:40
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 07cbda4c · raw item cf9b3988 · origin live

YouTubeT24 TELANGANA ADILABADMedia organisation95%20 May, 20:06 IST
Nirmal (99% conf.)Telugustance: neutral17 views · 1 likes · 0 comments

నిర్మల్ జిల్లా భైంసా పట్టణంతో ఎరువుల దుకాణాల తనిఖీలు

Original — Telugu

నిర్మల్ జిల్లా భైంసా పట్టణంతో ఎరువుల దుకాణాల తనిఖీలు

Show full source text as published

నిర్మల్ జిల్లా భైంసా పట్టణంతో ఎరువుల దుకాణాల తనిఖీలు నిర్మల్ జిల్లా భైంసా పట్టణంతో ఎరువుల దుకాణాల తనిఖీలు

English · AI translation

Fertilizer shop inspections in Bhainsa town, Nirmal district.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer shops were inspected in Bhainsa town, Nirmal district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2262ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 8df4d9e0 · raw item a9d7e5ac · origin live

YouTubesupertvtelugu newsMedia organisation95%18 May, 18:30 IST
Wanaparthy (99% conf.)Telugustance: neutral4 views · 0 likes · 0 comments

వనపర్తి జిల్లా డీఎస్పీ ఆనంద్ రెడ్డి ఎరువుల దుకాణాల యజమానులను హెచ్చరించారు

Original — Telugu

Supertv Telugu Mainly Focus on Political news and Crime News and All District News

Show full source text as published

వనపర్తి జిల్లా డీఎస్పీ ఆనంద్ రెడ్డి ఎరువుల దుకాణాల యజమానులను హెచ్చరించారు Supertv Telugu Mainly Focus on Political news and Crime News and All District News Welcome to the Official YouTube channel of Supertv Telugu . Catch all the latest Movie News, Political News Tollywood Updates, Telugu Movie News, Political News. we bring you all the exclusive and Latest Gossips of your Favorite actors, Unknown Facts, Rare Videos & photos, Tollywood Updates, Movie reviews, latest news, Trailers, Latest Video Songs etc.

English · AI translation

Wanaparthy district DSP Anand Reddy warned the owners of fertilizer shops.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Wanaparthy district DSP Anand Reddy warned fertilizer shop owners.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 72%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1496ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:55
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention e6c6e95a · raw item 361b819d · origin live

YouTubeT24 News AdilabadMedia organisation94%17 Jan, 20:28 IST
Nirmal · kubeer (98% conf.)Telugustance: neutral8 views · 1 likes · 0 comments

నిర్మల్ జిల్లా కుబీర్లో ఎరువు బస్తాలకోసం రైతుల పడిగాపులు

Original — Telugu

నిర్మల్ జిల్లా కుబీర్లో ఎరువు బస్తాలకోసం రైతుల పడిగాపులు

Show full source text as published

నిర్మల్ జిల్లా కుబీర్లో ఎరువు బస్తాలకోసం రైతుల పడిగాపులు నిర్మల్ జిల్లా కుబీర్లో ఎరువు బస్తాలకోసం రైతుల పడిగాపులు

English · AI translation

Farmers are waiting in Kubeer, Nirmal district, for fertilizer bags.

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Farmers are waiting in Kubeer, Nirmal district, for fertilizer bags.” · confidence 99%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1829ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 74b2d399 · raw item 9db6288b · origin live

YouTubeTV9 Telugu DigitalMedia organisation98%15 Jan, 21:38 IST
Mahabubabad (96% conf.)Telugustance: neutral463 views · 2 comments

ఈ ఎరువులు వాడితే చాలు.. పుష్కలంగా పంటలు! | Phosphate Solubilizing Bacteria | Mahabubabad - TV9

Original — Telugu

ఈ ఎరువులు వాడితే చాలు.. పుష్కలంగా పంటలు! | Phosphate Solubilizing Bacteria | Mahabubabad - TV9

Show full source text as published

ఈ ఎరువులు వాడితే చాలు.. పుష్కలంగా పంటలు! | Phosphate Solubilizing Bacteria | Mahabubabad - TV9 ►TV9 Website : https://tv9telugu.com/ ►News Watch : https://bit.ly/3g9b8IG ►KNOW THIS : https://bit.ly/3APEpAj ►PODCAST : https://bit.ly/3g7muNw ► Download Tv9 Android App: http://goo.gl/T1ZHNJ ► Download Tv9 IOS App: https://goo.gl/abC1bS #PhosphateSolubilizingBacteria #Mahabubabad #PSB

English · AI translation

These fertilizers are enough.. abundant crops! | Phosphate Solubilizing Bacteria | Mahabubabad - TV9

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Using phosphate solubilizing bacteria can help achieve abundant crop yields.” · confidence 78%

Sentiment: positiveStance toward government: neutralTelangana relevance: 82%Agriculture relevance: 96%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2235ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention d583a29a · raw item 8c008151 · origin live

YouTubeKhammam TvMedia organisation93%17 Dec, 20:42 IST
Khammam (98% conf.)Telugustance: supportive62 views · 0 likes · 0 comments

జబర్దస్త్ టీవీ // KHAMMAM TV // కార్పొరేటర్ షేక్ మక్బూల్ సేంద్రియ ఎరువులు పంపిణీ

Original — Telugu

ఖమ్మం 23 వ డివిజన్ పరిధిలో ఉచితంగా సేంద్రియ ఎరువులు పంపిణీ చేశారు. ఖమ్మం మున్సిపల్ కార్పొరేషన్, మంత్రి పువ్వాడ అజయ్ కుమార్ సహకారం తో గృహాలు, వ్యాపార సముదాయాలు నుండి సేకరించిన తడి చేత్తను పాకబండ పార్క్ లో మార్చిన 500 కిలోల కంఫో‌స్ట ఎరువును డివిజన్ ప్రజలకు ఉచితంగా కార్పొరేటర్ షేక్ మక్బూల్, మున్సిపల్ సిబ్బంది తో కలిసి పంపిణీ చేశారు. డివిజన్ ప్రజలు ఎరువుతో పూల మొక్కలు, పండ్లు, కూరగాయలు ఆకు కూరలు ఎక్కువగా పండించి పర్యావరణ పరిరక్షణ కోసం కృషి చేయాలని మక్బుల్ కోరారు.

Show full source text as published

జబర్దస్త్ టీవీ // KHAMMAM TV // కార్పొరేటర్ షేక్ మక్బూల్ సేంద్రియ ఎరువులు పంపిణీ ఖమ్మం 23 వ డివిజన్ పరిధిలో ఉచితంగా సేంద్రియ ఎరువులు పంపిణీ చేశారు. ఖమ్మం మున్సిపల్ కార్పొరేషన్, మంత్రి పువ్వాడ అజయ్ కుమార్ సహకారం తో గృహాలు, వ్యాపార సముదాయాలు నుండి సేకరించిన తడి చేత్తను పాకబండ పార్క్ లో మార్చిన 500 కిలోల కంఫో‌స్ట ఎరువును డివిజన్ ప్రజలకు ఉచితంగా కార్పొరేటర్ షేక్ మక్బూల్, మున్సిపల్ సిబ్బంది తో కలిసి పంపిణీ చేశారు. డివిజన్ ప్రజలు ఎరువుతో పూల మొక్కలు, పండ్లు, కూరగాయలు ఆకు కూరలు ఎక్కువగా పండించి పర్యావరణ పరిరక్షణ కోసం కృషి చేయాలని మక్బుల్ కోరారు. కార్యక్రమంలో రాంరెడ్డి, BRS నాయకులు షేక్ జామాల్, జయ ప్రకాష్, షేక్ సలీం, SK.అజు, షేక్ లాలా, శ్రీకాంత్, RP మహేశ్వరి, మహిళా నాయకులు L.ఝాన్సీ, లత, మహాలక్ష్మి, రాంబాయి, విమలా, జ్యోతి, ఆశా, నిర్మాల మున్సిపల్ సిబ్బంది మల్లయ్య, వేంకట నారయణ, శేఖర్ తదితరులు పాల్గొన్నారు.

English · AI translation

Jabardasth TV // KHAMMAM TV // Corporator Shake Makhbool distributes organic fertilizer In the area of Khammam 23rd division, organic fertilizer was distributed free of cost. With the cooperation of the Khammam Municipal Corporation and Minister Puvvada Ajay Kumar, 500 kilograms of compost fertilizer made from wet waste collected from households and business complexes and converted at Pakabanda Park was distributed free of cost to the division residents by Corporator Shake Makhbool along with municipal staff. Makhbool appealed to the division residents to work for environmental protection by growing more flowers, fruits, vegetables and leafy vegetables using the fertilizer.

fertilizer-availabilityhorticulture
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“500 kilograms of compost fertilizer made from wet waste was distributed free of cost to residents of Khammam 23rd division.” · confidence 95%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 97%Agriculture relevance: 71%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3009ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:40
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 18ae1a90 · raw item 2d36423c · origin live

YouTubeTRANSFARMER 👨‍🌾Creator74%11 Dec, 19:35 IST
Jagtial (96% conf.)Englishstance: neutral8 views · 1 likes · 0 comments

sai hanman fertilizer shop rajarampally endapelli jagtial telangana

Original — English

sai hanman fertilizer shop rajarampally endapelli jagtial telangana

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Sai Hanman fertilizer shop is in Rajarampally, Endapelli, Jagtial, Telangana.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 90%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1408ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:28
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 9e391628 · raw item c4a4723c · origin live

YouTubePSR Sagar 3 Creator90%2 Dec, 06:47 IST
Khammam · Khammam Rural (97% conf.)Telugustance: neutral200 views · 6 likes · 0 comments

రైతుకి శుభవార్త ఖమ్మం రూరల్ మండలం మనిషి పెంటతో తయారైన ఎరువు ప్రతి రైతు ఇది వాడితే పంటకి చాలా బలం

Original — Telugu

రైతుకి శుభవార్త కమ్మర్ రూరల్ మండలం మనిషి పెంటతో తయారైన ఎరువు ప్రతి రైతు ఇది వాడితే పంటకి చాలా బలంగా @psrsagar3 ఖమ్మం రూరల్ మండలం దానవాయిగూడెం వద్ద రైతుకు సంబంధించిన మంచి మనిషి పెంటతో తయారైన ఎరువుని ఫ్రీగా ఇస్తున్నారు ఈ ప్రాంతంలో ఉన్నవాళ్లు చాలామంది వాడారు వాడారు అయితే ప్రతి రైతు సోదరులందరికీ నా నమస్కారాలు నా వీడియో చూసి మీరు కూడా ట్రై చేయండి పత్తి పొలాల్లో గాని మిరప తోటలో గాని మగాడి పొలంలో గాని పుచ్చకాయ పొలంలో గాని ప్రతి పొలంలో ఇది చాలా బాగా పనిచేస్తుంది ఇది మీరు కావాలనుకుంటే నా నెంబర్ పెడతాను 9000 62 57 98 ఈ నెంబర్ కి కాల్ చేసి డీటెయిల్ తెలుసుకోండి నేనైతే డీటెయిల్ మొత్తం డిస్ప్లేషన్లో రాశాను దానవాయిగూడెం కాల్వకట్ట పక్కన ఈ ఫ్యాక్టరీ ఉంది చాలా దేశాలకు పంపిస్తున్నారు ఇప్పుడైతే ఫ్రీగానే ఇస్తారు తర్వాత మీకు కావాలనుకున్నప్పుడల్లా ఫ్రీగా రాదు. ఫ్రీగా పొందాల్సిన వాళ్లు మీరు తీసుకోవచ్చు ఈ వీడియోను చూడండి పూర్తిగా చూశాక మీకు అర్థమవుతుంది ప్రతి రైతు సోదరులకు నేను చెప్పే మాట పూర్తిగా నమ్మండి నేను అక్కడికి ఆ ఫ్యాక్టరీ కాడికి వెళ్లి అన్ని డీటెయిల్స్ కనుక్కున్నాను మీకు చెప్తున్నాను ఈ వీడియో రూపంలో 🙏🚩🇮🇲🙏🙏🙏🙏

English · AI translation

Good news for farmers: a fertilizer made from human manure in Khammam Rural mandal will greatly strengthen crops if every farmer uses it. Good news for farmers: a fertilizer made from human manure in Khammam Rural mandal will greatly strengthen crops. @psrsagar3 At Danavaigudem in Khammam Rural mandal, a good fertilizer made from human manure related to farming is being given free to farmers. Many people in this area have used it. Greetings to all farmer brothers. After watching my video, you should also try it. It works very well in cotton fields, chilli gardens, and every field. If you want, I will add my number: 9000 62 57 98. Call this number and find out the details. I have written all the details in the description. There is a factory next to the canal at Danavaigudem. It is being sent to many countries. Right now it is being given free; later it will not be free whenever you want. Those who want to get it free can take it. Watch this video. After watching it completely, you will understand. I tell all farmer brothers: believe it completely. I went there to the factory and found out all the details, and I am telling you in the form of this video 🙏🚩🇮🇲🙏🙏🙏🙏

fertilizer-availabilitycottonchilli
Open original source ↗
AI interpretation & provenance
Extracted claim

“A fertilizer made from human manure is being distributed free of cost near Danavaigudem, Khammam Rural mandal.” · confidence 94%

Sentiment: positiveStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 97%Classification confidence: 88%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 5574ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention f567acb5 · raw item 2a67bce1 · origin live

YouTubeSSC KARIMNAGAR NEWSMedia organisation90%12 Sept, 18:51 IST
Karimnagar (94% conf.)Telugustance: neutral23 views · 1 likes · 0 comments

సేంద్రియ ఎరువులు ...SSC NEWS KARIMNAGAR 12-09-2022

Original — Telugu

#SSC #KARIMNAGAR #NEWS #నిజం...మా నైజం...

English · AI translation

Organic fertilizers ... SSC NEWS KARIMNAGAR 12-09-2022 #SSC #KARIMNAGAR #NEWS #Truth...our nature...

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content is about organic fertilizers.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 60%Agriculture relevance: 60%Classification confidence: 81%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3008ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:37
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention c7c8d93d · raw item 8eb7efbc · origin live

YouTubeBharat Today 24x7 Media organisation98%22 Jul, 13:08 IST
Yadadri Bhuvanagiri (98% conf.)Telugustance: neutral29 views · 3 likes · 0 comments

యాదాద్రి భువనగిరి జిల్లాలో నకిలీ ఎరువుల కలకలం | Bharat Today

Original — Telugu

Bharat Today is Nationalist TV Channel

Show full source text as published

యాదాద్రి భువనగిరి జిల్లాలో నకిలీ ఎరువుల కలకలం | Bharat Today యాదాద్రి భువనగిరి జిల్లాలో నకిలీ ఎరువుల కలకలం | Bharat Today #yadadri #fakefertilizers #bharattoday Bharat Today is Nationalist TV Channel Subscribe To Bharat Today Official YouTube Channel : https://www.youtube.com/channel/UCtlOBrA93cytbIp0YzX_0YA?sub_confirmation=1 Bharat Today customized URL : https://www.youtube.com/bhaarattodaynew Visit Our Website: http://www.bhaarattoday.com @ Like Us on SwamiParipoornananda Team Page : https://www.facebook.com/SwamiParipoornanandaTeamPage For More Garam Chai With Dharam Bhai : https://www.youtube.com/channel/UCWxYZLqTyL2DXEQ4xqE-VUA Like Us on Facebook: https://www.facebook.com/BharatTodayNews Follow Us on Twitter : https://twitter.com/BharatToday "Bharat Today" Channel Owned by 𝗝𝗮𝗻𝗮𝗺 𝗜𝗻𝗳𝗼𝘁𝗮𝗶𝗻𝗺𝗲𝗻𝘁 𝗣𝗿𝗶𝘃𝗮𝘁𝗲 𝗟𝗶𝗺𝗶𝘁𝗲𝗱. Bharat Today a Unique Television Channel Aimed At Portraying and Inculcating the True Spirit of Vibrant culture Among People and Enabling Every Person to be Moulded as an Indian Force to Reckon with Through Various Creative Programs. Channel Dedicated to Breaking News, Hinduism News, General News, Live Reports, Sports News, Weather News, Entertainments, Business Updates, Big Debates,Exclusive Interviews etc., Thank You - Bharat Today Team

English · AI translation

Fake fertilizer stir in Yadadri Bhuvanagiri district | Bharat Today Bharat Today is Nationalist TV Channel

fertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There is a stir over fake fertilizers in Yadadri Bhuvanagiri district.” · confidence 86%

Sentiment: negativeStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1994ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention c5c31ed6 · raw item 31ff5445 · origin live

YouTubeRuling1tv News Telugu&UrduMedia organisation97%25 Jun, 23:45 IST
Khammam (98% conf.)Telugustance: neutral9 views · 1 likes · 0 comments

నకిలీ విత్తనాలు, ఎరువులు విక్రయిస్తే చర్యలు తప్పవు..;; ఖమ్మం సిపి విష్ణు ఎస్ వారియర్...

Original — Telugu

నకిలీ విత్తనాలు, ఎరువులు విక్రయిస్తే చర్యలు తప్పవు..;; ఖమ్మం సిపి విష్ణు ఎస్ వారియర్...

English · AI translation

If fake seeds and fertilizers are sold, action will be taken..;; Khammam CP Vishnu S Warrior...

seedsfertilizer-availabilityfake-seeds
Open original source ↗
AI interpretation & provenance
Extracted claim

“If fake seeds and fertilizers are sold, action will be taken.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2024ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 81449a7c · raw item 744dbdfb · origin live

YouTubeRK KANNA CREATION'SCreator92%24 Jun, 17:00 IST
Jogulamba Gadwal · aiza (99% conf.)Telugustance: neutral5,264 views · 55 likes · 3 comments

పత్తి పంటలో సేద్యం చేస్తూ ఎరువులు పెడుతున్న రైతన్న తూంకుంట గ్రామం అయిజ మండలం జోగులాంబ గద్వాల్ జిల్లా

Original — Telugu

పత్తి పంటలో సేద్యం చేస్తూ ఎరువులు పెడుతున్న రైతన్న తూంకుంట గ్రామం అయిజ మండలం జోగులాంబ గద్వాల్ జిల్లా

English · AI translation

A farmer is irrigating a cotton crop and applying fertilizers in Thoongunta village, Aiza mandal, Jogulamba Gadwal district.

fertilizer-availabilitycotton
Open original source ↗
AI interpretation & provenance
Extracted claim

“A farmer is applying fertilizers while irrigating a cotton crop in Thoongunta village, Aiza mandal, Jogulamba Gadwal district.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 94%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2503ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 6f53af77 · raw item f2f57ad4 · origin live

YouTubetelaganaNewsMedia organisation95%13 May, 23:06 IST
Sangareddy (99% conf.)Telugustance: neutral1 views · 0 likes · 0 comments

MSNews/కల్తీ విత్తనాలు కల్తీ ఎరువులు పై ఉక్కుపాదం సంగారెడ్డి జిల్లా ఎస్పీ రమణ కుమార్ ఆదేశాలమేరకు

Original — Telugu

కల్తీ విత్తనాలు కల్తీ ఎరువులు పై ఉక్కుపాదం సంగారెడ్డి జిల్లా ఎస్పీ రమణ కుమార్ ఆదేశాలమేరకు డిఎస్పీ సిఐ ఎస్ ఐ కొండాపూర్ రవి ఎయి ఓ సంయుక్తంగా శుక్రవారం మల్కాపూర్ లోని మణికంఠ ట్రేడర్స్ పై ఆకస్మిక తనిఖీ నిర్వహించి కల్తీ విత్తనాలు ఎరువులు గురించి వెతకగా ఏమీ లభించలేదు ఎవరైనా అటువంటి కల్తీకి పాల్పడి రైతు లను మోసం చేస్తే కఠిన చర్యలు తీసుకుంటామని తెలిపారు.

English · AI translation

On the orders of Sangareddy District SP Raman Kumar, a joint surprise inspection was conducted on Friday at Manikanta Traders in Malkapur by DSP, CI, SI, and AEO regarding fake seeds and fake fertilizers. Nothing was found, and they said that if anyone indulges in such adulteration and cheats farmers, strict action will be taken.

seedsfertilizer-availabilityfake-seeds
Open original source ↗
AI interpretation & provenance
Extracted claim

“An inspection was conducted at Manikanta Traders in Malkapur and no fake seeds or fake fertilizers were found.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2251ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:53
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 96926c24 · raw item 16433116 · origin live

YouTubeANJALI TV TELUGUMedia organisation92%2 Dec, 18:25 IST
Yadadri Bhuvanagiri · bhongir (87% conf.)Telugustance: neutral9 views · 2 likes · 0 comments

రైతువేదిక క్లస్టర్ లో ఎరువులు,మందులదుకాణదారులకు జిల్లా అదనపు కలెక్టర శిక్షణ కార్యక్రమం నిర్వహించారు.

Original — Telugu

యాదాద్రి భువనగిరి జిల్లా... భువనగిరి మండలం ముత్తిరెడ్డిగూడెం రైతు వేదిక క్లస్టర్ లో గ్రామం లో విత్తనాలు ఎరువులు పురుగుల మందుల దుకాణదారులకు యాదాద్రి భువనగిరి జిల్లా అదనపు కలెక్టర్ దీపక్ తివారి శిక్షణ కార్యక్రమం నిర్వహించారు. జిల్లా వ్యవసాయ శాఖ అధికారి అనురాధ, సంబంధిత శాఖ అధికారులు...

English · AI translation

A training program was conducted in the Rythu Vedika cluster for fertilizer and pesticide shop dealers by the district additional collector. Yadadri Bhuvanagiri district... In the Rythu Vedika cluster in Muthireddygudem village, Bhongir mandal, Yadadri Bhuvanagiri district additional collector Deepak Tiwari conducted a training program for seed, fertilizer, and pesticide shop dealers. District Agriculture Officer Anuradha and concerned department officials...

fertilizer-availabilityseedspest-outbreak
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The Yadadri Bhuvanagiri district additional collector conducted a training program for seed, fertilizer, and pesticide shop dealers at the Rythu Vedika cluster in Muthireddygudem village, Bhongir mandal.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3167ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:44
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 081f74d9 · raw item b81a9759 · origin live

YouTubesnews khammamMedia organisation95%9 Sept, 20:39 IST
Khammam · konijerla (98% conf.)Telugustance: neutral33 views · 1 likes · 0 comments

ఖమ్మం కొణిజర్ల మండలంలోనకిలీ ఎరువులు,మందులు విక్రయిస్తున్నఎజంట్లను పట్టుకున్నవ్యవసాయశాఖ అధికారులు

Original — Telugu

ఖమ్మం జిల్లాలోని తాజా వార్తలను ఎప్పటికప్పుడు S న్యూస్ ప్రేక్షకులకు అందిస్తుంది. లేటెస్ట్ అప్ డేట్, పొలిటికల్ వార్తల కోసం S న్యూస్ ను వీక్షించండి.మీ కళ్ల ముందు జరిగే వింతలు విశేషాలు, ఏమైన స్థానిక సమస్యలు ఉంటే మా దృష్టికి తీసుకురాండి. వాటిని అధికారులు, ప్రజాప్రతినిధుల దృష్టికి తీసుకెళ్లి పరిష్కారం చూపే ప్రయత్నం చేస్తాము. మా WhatsApp no:9154863418,9059979749

English · AI translation

Agriculture department officials caught agents selling fake fertilizers and medicines in Konijerla mandal of Khammam district. S News provides Khammam district's latest news to S News viewers from time to time. For the latest updates and political news, watch S News. If you have any strange or interesting local issues happening before your eyes, bring them to our attention. We will try to take them to the attention of the officials and public representatives and find a solution. Our WhatsApp no: 9154863418, 9059979749

fertilizer-availabilityseedsfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Agriculture department officials caught agents selling fake fertilizers and medicines in Konijerla mandal of Khammam district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2756ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:40
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 14cbeb77 · raw item 55804374 · origin live

YouTubeSWETHA TVMedia organisation93%2 Aug, 03:48 IST
Karimnagar (98% conf.)Telugustance: neutral258 views · 11 likes · 1 comments

కరీంనగర్ చేరుకున్న కెకె బిర్లగ్రూప్ ఎరువులు...SWETHA NEWS 01.08.2021

Original — Telugu

#SWETHANEWS #ప్రజలకోసం-ప్రగతికోసం #KARIMNAGAR

English · AI translation

KK Birla Group fertilizers have reached Karimnagar... SWETHA NEWS 01.08.2021 #SWETHANEWS #For the people-For development #KARIMNAGAR

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“KK Birla Group fertilizers have reached Karimnagar.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 86%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1746ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:37
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention c0e6d915 · raw item 1b921884 · origin live

YouTubeSSC KARIMNAGAR NEWSMedia organisation90%2 Aug, 03:38 IST
Karimnagar (99% conf.)Telugustance: neutral11 views · 0 likes · 0 comments

కరీంనగర్ చేరుకున్న కెకె బిర్లగ్రూప్ ఎరువులు...SSC KARIMNAGAR NEWS 01.08.2021

Original — Telugu

#SSC #KARIMNAGAR #NEWS #నిజం...మా నైజం...

English · AI translation

KK Birla Group fertilizers have reached Karimnagar... SSC KARIMNAGAR NEWS 01.08.2021 #SSC #KARIMNAGAR #NEWS #Truth...our nature...

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“KK Birla Group fertilizers have reached Karimnagar.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 92%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2234ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:35
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 3929281c · raw item d9114d39 · origin live

YouTubeMahabubabad District NewsMedia organisation98%20 Jul, 23:10 IST
Mahabubabad (72% conf.)Telugustance: neutral72 views · 4 likes · 0 comments

పొలంలో ఎరువులు తయారీ l A.O రవీందర్ రెడ్డి @MHBDNews

Original — Telugu

పొలంలో ఎరువులు తయారీ l A.O రవీందర్ రెడ్డి @MHBDNews

Show full source text as published

పొలంలో ఎరువులు తయారీ l A.O రవీందర్ రెడ్డి @MHBDNews https://youtu.be/1N4elMDysbA https://youtu.be/8mjaUfJpH50 https://youtu.be/r6I1YG-d2S4

English · AI translation

Fertilizer production in the field | A.O. Ravinder Reddy @MHBDNews

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“The content refers to fertilizer production in a field.” · confidence 62%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 78%Classification confidence: 74%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1951ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:41
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  7. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  8. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  9. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 18dce686 · raw item 4070e1c7 · origin live

YouTubeT News teluguMedia organisation96%23 Jun, 13:47 IST
Jayashankar Bhupalpally (98% conf.)Englishstance: neutral130 views · 4 likes

MLA Gandra Venkata Ramana Reddy Inaugurates Fertilizer Center In Laxmareddypally Village | T News

Original — English

MLA Gandra Venkata Ramana Reddy Inaugurates Fertilizer Center In Laxmareddypally Village, Jayashankar Bhupalpally | T News

Show full source text as published

MLA Gandra Venkata Ramana Reddy Inaugurates Fertilizer Center In Laxmareddypally Village | T News MLA Gandra Venkata Ramana Reddy Inaugurates Fertilizer Center In Laxmareddypally Village, Jayashankar Bhupalpally | T News -- TNews is a 24/7 Telugu news channel now on YouTube.The first Telangana news channel featuring best news from all around the world. We deliver breaking news, live reports, exclusive interviews, political debates, sports, weather, entertainment, business updates and current affairs. -----*****----- *** Subscribe to Tnews for more videos: https://www.youtube.com/c/TNewsTelugu​ ► T News Live: https://www.youtube.com/channel/UCF4B...​ ► Like us on Facebook: https://www.facebook.com/tnewstelugu​ ► Visit Our Website: https://tnewstelugu.com​ ► Follow us on Twitter: https://twitter.com/TNewstelugu​ ► Follow us on Instagram https://www.instagram.com/tnewstelugu/​ ► CM KCR LIVE | సీఎం కేసీఆర్ ప్రగతి పర్యటన | T News : https://www.youtube.com/watch?v=XySrSd7YuzQ&list=PLP0Z5mXNfIrufX610Kb37BPmCDD4s2tIf ► Dhoom Dhaam Muchata| T News - Exclusive: https://www.youtube.com/playlist?list=PLP0Z5mXNfIruofcBhbJu2iiRJsLzXgSZI ► T News Special Stories - Exclusive : https://www.youtube.com/playlist?list=PLP0Z5mXNfIrsAAnINJgYfTbqamMSpHK9X ► మంత్రి ఈటెల వంద ఎకరాల భూకబ్జా.. | T News: https://youtu.be/QSc_oUKR5W8​ #MLAGandraVenkataRamanaReddy #FertilizerCenter #JayashankarBhupalpally #TnewsLive #TelanganaNews #TeluguLiveTVchannel #TnewsLiveupdates #Tnews #Telangana ＬＩＫＥ | ＣＯＭＭＥＮＴ | ＳＨＡＲＥ | ＳＵＢＳＣＲＩＢＥ -----*****-----

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“MLA Gandra Venkata Ramana Reddy inaugurated a fertilizer center in Laxmareddypally village, Jayashankar Bhupalpally.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 70%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1744ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:29
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 011b8f2e · raw item 06106670 · origin live

YouTubeT News teluguMedia organisation96%11 Jun, 12:25 IST
Karimnagar (95% conf.)Telugu / Englishstance: neutral228 views · 12 likes

ఎరువులు, విత్తనాల కొరతకు చెక్ | No Shortage of Seeds & Fertilizers | Telangana | T News

Original — Telugu / English

ఎరువులు, విత్తనాల కొరతకు చెక్ | No Shortage of Seeds & Fertilizers | Telangana | Karimnagar Agriculture officer Face to Face | T News

Show full source text as published

ఎరువులు, విత్తనాల కొరతకు చెక్ | No Shortage of Seeds & Fertilizers | Telangana | T News ఎరువులు, విత్తనాల కొరతకు చెక్ | No Shortage of Seeds & Fertilizers | Telangana | Karimnagar Agriculture officer Face to Face | T News -- TNews is a 24/7 Telugu news channel now on YouTube.The first Telangana news channel featuring best news from all around the world. We deliver breaking news, live reports, exclusive interviews, political debates, sports, weather, entertainment, business updates and current affairs. -----*****----- *** Subscribe to Tnews for more videos: https://www.youtube.com/c/TNewsTelugu​ ► T News Live: https://www.youtube.com/channel/UCF4B...​ ► Like us on Facebook: https://www.facebook.com/tnewstelugu​ ► Visit Our Website: https://tnewstelugu.com​ ► Follow us on Twitter: https://twitter.com/TNewstelugu​ ► Follow us on Instagram https://www.instagram.com/tnewstelugu/​ ► T News Special Stories - Exclusive: https://www.youtube.com/playlist?list=PLP0Z5mXNfIrsAAnINJgYfTbqamMSpHK9X ► Dhoom Dhaam Muchata| T News - Exclusive: https://www.youtube.com/playlist?list=PLP0Z5mXNfIruofcBhbJu2iiRJsLzXgSZI ► T News Special Stories - Exclusive : https://www.youtube.com/playlist?list=PLP0Z5mXNfIrsAAnINJgYfTbqamMSpHK9X ► మంత్రి ఈటెల వంద ఎకరాల భూకబ్జా.. | T News: https://youtu.be/QSc_oUKR5W8​ #KCRGovt #NoShortageofSeeds&Fertilizers #Telangana #TNews #TnewsLive #TelanganaNews #TeluguLiveTVchannel #TnewsLiveupdates #Tnews #Telangana ＬＩＫＥ | ＣＯＭＭＥＮＴ | ＳＨＡＲＥ | ＳＵＢＳＣＲＩＢＥ -----*****-----

English · AI translation

Check on shortages of fertilizers and seeds | No Shortage of Seeds & Fertilizers | Telangana | T News Check on shortages of fertilizers and seeds | No Shortage of Seeds & Fertilizers | Telangana | Karimnagar Agriculture officer Face to Face | T News

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Karimnagar Agriculture officer says there is no shortage of seeds and fertilizers.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 95%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2177ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:38
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention f8528800 · raw item f78a80a4 · origin live

YouTubeRSN TV TELANGANAMedia organisation95%7 Jun, 22:32 IST
Sangareddy (98% conf.)Telugustance: neutral1 views · 0 likes · 0 comments

సంగారెడ్డి // విత్తనాలు,ఎరువులు అందుబాటులోఉంచాలి :రైతు సంఘం జిల్లా నాయకులు జయరాజు// RSNTV TELANGANA

Original — Telugu

RSN TV Telangana Reports especially politics and public issues from time to time live stream .

Show full source text as published

సంగారెడ్డి // విత్తనాలు,ఎరువులు అందుబాటులోఉంచాలి :రైతు సంఘం జిల్లా నాయకులు జయరాజు// RSNTV TELANGANA Please Subscribe : https://www.youtube.com/rsntvtelangana?sub_confirmation=1 RSN TV Telangana Reports especially politics and public issues from time to time live stream .

English · AI translation

Sangareddy // Seeds and fertilizers should be made available: farmer association district leader Jayaraju // RSN TV Telangana RSN TV Telangana reports especially politics and public issues from time to time live stream.

seedsfertilizer-availabilityseed-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Seeds and fertilizers should be made available.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2122ms)

Processing trail
  1. NORMALIZED · 17 Sept, 15:47
  2. RELEVANCE_ACCEPTED · 17 Sept, 15:49
  3. ENRICHED · 17 Sept, 15:54
  4. DEDUPED · 17 Sept, 15:56
  5. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  6. NARRATIVE_ASSIGNED · 17 Sept, 15:56
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  12. NARRATIVE_ASSIGNED · 20 Sept, 05:57

mention 78e4572c · raw item 09f83406 · origin live

YouTubeBahujana 9 News Media organisation92%28 May, 20:04 IST
Mahabubabad (86% conf.)Telugustance: neutral2 views · 0 likes · 0 comments

మహబూబాబాద్ పార్లమెంట్కోవిడ్ 19 ధాన్యం కొనుగోలు, విత్తనాలు, ఎరువుల పంపిణీ MPమాలోత్ కవిత పాల్గొన్నారు

Original — Telugu

Bulletin|Bahujana 9 News

English · AI translation

Mahabubabad Parliament constituency: During COVID-19, grain procurement, seed distribution, and fertilizer distribution — MP Maloth Kavitha participated.

procurementseedsfertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“MP Maloth Kavitha participated in an event about grain procurement, seed distribution, and fertilizer distribution in Mahabubabad Parliament constituency.” · confidence 91%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 95%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2096ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10
  14. NARRATIVE_ASSIGNED · 20 Sept, 19:44
  15. NARRATIVE_ASSIGNED · 22 Sept, 02:32
  16. NARRATIVE_ASSIGNED · 22 Sept, 14:24
  17. NARRATIVE_ASSIGNED · 23 Sept, 02:39

mention 198fc0bc · raw item a957e209 · origin live

YouTubeL9Tv Telugu NewsMedia organisation98%26 May, 19:03 IST
Kamareddy (98% conf.)Telugustance: critical44 views · 4 likes · 0 comments

ప్రభుత్వం ఎరువులు పంపిణి చేయడంలో విఫలం చెందిందని రైతుల ఆగ్రహం || KAMAREDDY || L9TV TELUGUNEWS

Original — Telugu

ప్రభుత్వం ఎరువులు పంపిణి చేయడంలో విఫలం చెందిందని రైతుల ఆగ్రహం || #KAMAREDDY || #L9TVTELUGUNEWS

Show full source text as published

ప్రభుత్వం ఎరువులు పంపిణి చేయడంలో విఫలం చెందిందని రైతుల ఆగ్రహం || KAMAREDDY || L9TV TELUGUNEWS ప్రభుత్వం ఎరువులు పంపిణి చేయడంలో విఫలం చెందిందని రైతుల ఆగ్రహం || #KAMAREDDY || #L9TVTELUGUNEWS For More Update Please Subscribe : https://www.youtube.com/channel/UCaPmISE8DvugbzxirEl7MYg follow on facebook:https://www.facebook.com/L9tv-Telugu-News-103706175205233 website: http://l9tvtelugunews.com/

English · AI translation

Farmers are angry that the government failed to distribute fertilizers. || KAMAREDDY || L9TV TELUGUNEWS Farmers are angry that the government failed to distribute fertilizers. || #KAMAREDDY || #L9TVTELUGUNEWS

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers are angry because the government failed to distribute fertilizers.” · confidence 97%

Sentiment: negativeStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1522ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention e5f97641 · raw item 43e5baac · origin live

YouTubeTeja SamaCreator81%12 Apr, 09:51 IST
Jangaon (97% conf.)Englishstance: neutral305 views · 7 likes · 0 comments

Mahalaxmi Fertilizer Jangaon| ARSK| ARSK-2 Patelgudem Fertilizer stock available in old rates

Original — English

Mahalaxmi Fertilizer Jangaon| ARSK| ARSK-2 Patelgudem Fertilizer stock available in old rates

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer stock is available at old rates at Mahalaxmi Fertilizer Jangaon / ARSK / ARSK-2 Patelgudem.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 92%Agriculture relevance: 98%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2035ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:27
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 54e44080 · raw item eb43baf9 · origin live

YouTubeSWETHA TVMedia organisation93%29 Mar, 19:17 IST
Karimnagar (99% conf.)Telugustance: neutral7 views · 0 likes · 0 comments

కరీంనగర్ కు చేరుకున్న ఎఫ్సీఐ ఎరువులు SWETHA NEWS KARIMNAGAR 29-03-2021

Original — Telugu

కరీంనగర్ కు చేరుకున్న ఎఫ్సీఐ ఎరువులు SWETHA NEWS KARIMNAGAR 29-03-2021

English · AI translation

FCI fertilizers have arrived in Karimnagar. SWETHA NEWS KARIMNAGAR 29-03-2021

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“FCI fertilizers have arrived in Karimnagar.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2056ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:39
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention cc12c91b · raw item 5b90c255 · origin live

YouTubeSSC KARIMNAGAR NEWSMedia organisation90%22 Mar, 19:17 IST
Karimnagar (78% conf.)Telugustance: neutral5 views · 2 likes · 0 comments

సెంద్రీయ ఎరువులు వాడండి...SSC KARIMNAGAR NEWS 21.03.2021

Original — Telugu

సెంద్రీయ ఎరువులు వాడండి...SSC KARIMNAGAR NEWS 21.03.2021

English · AI translation

Use organic fertilizers... SSC Karimnagar News 21.03.2021

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The content says to use organic fertilizers.” · confidence 86%

Sentiment: neutralStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 90%Classification confidence: 90%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1718ms)

Processing trail
  1. NORMALIZED · 16 Sept, 05:27
  2. RELEVANCE_ACCEPTED · 16 Sept, 05:30
  3. ENRICHED · 16 Sept, 05:35
  4. DEDUPED · 16 Sept, 05:40
  5. NARRATIVE_ASSIGNED · 16 Sept, 05:40
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 8b103739 · raw item dd20fbdf · origin live

YouTubeDurga Siti CableMedia organisation97%17 Feb, 08:56 IST
Jagtial (99% conf.)Telugustance: neutral36 views · 0 likes · 0 comments

16.2.21| DSC | Jagtial | BJP ఆధ్వర్యంలో ఎరువుల పంపిణీ కై ధర్నా

Original — Telugu

| Durga Siti Cable | News | BJP ఆధ్వర్యంలో ఎరువుల పంపిణీ కై ధర్నా * Watch Durga Siti Cable News Everyday at 9.30pm & 8.30am * Social Media Finds New Role as News and Entertainment Curator

Show full source text as published

16.2.21| DSC | Jagtial | BJP ఆధ్వర్యంలో ఎరువుల పంపిణీ కై ధర్నా | Durga Siti Cable | News | BJP ఆధ్వర్యంలో ఎరువుల పంపిణీ కై ధర్నా * Watch Durga Siti Cable News Everyday at 9.30pm & 8.30am * Social Media Finds New Role as News and Entertainment Curator Watch #Live: http://www.durgasiticable.in/ Subscribe our YouTube Channel ► https://www.youtube.com/c/durgasiticable Visit our Website ►http://www.durgasiticable.in Facebook ►https://www.facebook.com/durgasiticable Twitter ► https://twitter.com/durgasiticable

English · AI translation

16.2.21| DSC | Jagtial | Dharna under BJP leadership for fertilizer distribution 16.2.21| DSC | Jagtial | BJP under leadership dharna for fertilizer distribution Watch Durga Siti Cable News Everyday at 9.30pm & 8.30am Social Media Finds New Role as News and Entertainment Curator

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A dharna was held under BJP leadership for fertilizer distribution in Jagtial.” · confidence 97%

Sentiment: negativeStance toward government: neutralTelangana relevance: 95%Agriculture relevance: 80%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2249ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 42cbc044 · raw item c8d20346 · origin live

YouTubesiti popular channelMedia organisation94%16 Feb, 22:26 IST
Jagtial (98% conf.)Telugustance: neutral4 views · 0 likes · 0 comments

రైతులకు ఉచిత ఎరువులు పంపిణీ రుణమాఫీ చేయాలని జగిత్యాల తాసిల్దార్ కు బిజెపి నాయకుల వినతి

Original — Telugu

#SITIPOPULARCHANNELJAGTIAL​​​​​​​​​​​​ | NEWS 16.02.2021

English · AI translation

BJP leaders submitted a request to the Jagityal tahsildar to provide free fertilizer distribution and loan waiver for farmers. #SITIPOPULARCHANNELJAGTIAL​​​​​​​​​​​​ | NEWS 16.02.2021

fertilizer-availabilityagricultural-creditloan-waiver
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“BJP leaders submitted a request to the Jagityal tahsildar for free fertilizer distribution and loan waiver for farmers.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 92%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2260ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:47
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention ef63882c · raw item 6df785e9 · origin live

YouTubeAcnChannel “Jagtial” NewsMedia organisation94%16 Feb, 21:06 IST
Jagtial (98% conf.)Telugustance: critical28 views · 1 likes · 0 comments

జగిత్యాల : రైతులకు ఉచిత ఎరువులు, ఋణ మాఫీ చేయాలని జిల్లా బీజేపీ ఆధ్వర్యంలో తహసీల్ ఆఫీస్ ముందు ధర్నా

Original — Telugu

జగిత్యాల : రైతులకు ఉచిత ఎరువులు, ఋణ మాఫీ చేయాలని జిల్లా బీజేపీ ఆధ్వర్యంలో తహసీల్ ఆఫీస్ ముందు ధర్నా

Show full source text as published

జగిత్యాల : రైతులకు ఉచిత ఎరువులు, ఋణ మాఫీ చేయాలని జిల్లా బీజేపీ ఆధ్వర్యంలో తహసీల్ ఆఫీస్ ముందు ధర్నా #AcnChannel #DailyNewsUpdates #Jagtial #acnchannel.com https://www.youtube.com/channel/UCiMHf3xEon8KadNzUjxfTXQ/join

English · AI translation

Jagtial: A dharna was held in front of the tahsildar office under the leadership of the district BJP demanding free fertilizers and loan waiver for farmers.

fertilizer-availabilityagricultural-creditloan-waiverloan-waiver
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A protest was held in front of the tahsildar office in Jagtial under the district BJP demanding free fertilizers and loan waiver for farmers.” · confidence 96%

Sentiment: neutralStance toward government: criticalTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2257ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:47
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 81c3ceeb · raw item bad48dab · origin live

YouTubesupertvtelugu newsMedia organisation95%4 Sept, 18:43 IST
Kamareddy · bibipet (99% conf.)Telugustance: neutral5 views · 0 likes · 0 comments

కామారెడ్డి జిల్లా బీబీపేట మండల కేంద్రములో ఎరువుల కోసం బారులు తీరిన రైతులు

Original — Telugu

Supertv Telugu Mainly Focus on Political news and Crime News and All District News

Show full source text as published

కామారెడ్డి జిల్లా బీబీపేట మండల కేంద్రములో ఎరువుల కోసం బారులు తీరిన రైతులు Supertv Telugu Mainly Focus on Political news and Crime News and All District News Welcome to the Official YouTube channel of Supertv Telugu . Catch all the latest Movie News, Political News Tollywood Updates, Telugu Movie News, Political News. we bring you all the exclusive and Latest Gossips of your Favorite actors, Unknown Facts, Rare Videos & photos, Tollywood Updates, Movie reviews, latest news, Trailers, Latest Video Songs etc.

English · AI translation

Farmers lined up for fertilizers at the Bibipet mandal center in Kamareddy district

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Farmers lined up for fertilizers at the Bibipet mandal center in Kamareddy district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 90%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1845ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:42
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 5a9eb42d · raw item 896cd98f · origin live

YouTubePrime9 NewsMedia organisation98%25 Aug, 19:51 IST
Kamareddy (99% conf.)Telugu / Englishstance: neutral158 views · 2 likes · 0 comments

ఎరువుల దుకాణాల తనిఖీ | Special Story On Inspections of Fertilizer Stores In kamareddy Dist | Prime9

Original — Telugu / English

#ఎరువులదుకాణాల తనిఖీ | Special Story On Inspections of #Fertilizer Stores In #kamareddy Dist | Prime9 Similar Questions & Tags :-

Show full source text as published

ఎరువుల దుకాణాల తనిఖీ | Special Story On Inspections of Fertilizer Stores In kamareddy Dist | Prime9 Watch News, Politics, Sports, Business news, film news, Technology News, Latest updates, Celebrity information, Movie releases. #TeluguNews #Prime9News #BreakingNews #ఎరువులదుకాణాల తనిఖీ | Special Story On Inspections of #Fertilizer Stores In #kamareddy Dist | Prime9 ►For More Updates: Please Subscribe me ► https://bit.ly/2LSuGk8 ►Like Us in Facebook:► https://facebook.com/prime9news ►Follow Me On Twitter ► https://twitter.com/prime9news ►Follow Me On Instagram -https://www.instagram.com/prime9news/ Similar Questions & Tags :- #telugunews #breakingnews #latestnews #prime9news #prime9newstelugu #Andhrapradesh #Telangana #telugu #Prime9media #Amaravathi #vizag #kurnool #Hyderabad #newswithprime9 #telugumedia

English · AI translation

Inspection of fertilizer shops | Special story on inspections of fertilizer stores in Kamareddy district | Prime9 #Inspection of fertilizer shops | Special story on #Fertilizer stores in #Kamareddy district | Prime9 Similar Questions & Tags :-

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Fertilizer store inspections are being conducted in Kamareddy district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 94%Classification confidence: 96%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2653ms)

Processing trail
  1. NORMALIZED · 10 Sept, 05:56
  2. RELEVANCE_ACCEPTED · 10 Sept, 05:56
  3. ENRICHED · 10 Sept, 05:57
  4. DEDUPED · 10 Sept, 05:57
  5. NARRATIVE_ASSIGNED · 10 Sept, 05:58
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 8e51f4b8 · raw item b46d8a21 · origin live

YouTubeTS9 NEWSMedia organisation99%31 Jul, 22:17 IST
Kamareddy · nagarajunasagar? (95% conf.)Telugustance: neutral9 views · 2 likes · 0 comments

కామారెడ్డి నాగిరెడ్డిపేట్ లో ఎరువుల కంపోస్ట్ కేంద్రాలను ఏర్పాటు చేయాలన్న జిల్లా కలెక్టర్

Original — Telugu

For More Latest News And Hindu Dharma Based And News Updates

Show full source text as published

కామారెడ్డి నాగిరెడ్డిపేట్ లో ఎరువుల కంపోస్ట్ కేంద్రాలను ఏర్పాటు చేయాలన్న జిల్లా కలెక్టర్ For More Latest News And Hindu Dharma Based And News Updates  Subscribe To Our Youtube Channel :https://www.youtube.com/ts9news  Download ts9 channel App:https://play.google.com/store/apps/details?id=com.ts9.ts9&hl=en_IN  Visit Our Website: http://www.ts9.tv  Like Us in Facebbok: https://www.facebook.com/pg/ts9news  Follow Us in Twitter : https://twitter.com/ts9news  InGooglePlus:https://plus.google.com/u/0/?tab=wX

English · AI translation

The district collector has said that fertilizer compost centers should be established in Nagireddipet, Kamareddy. For more latest news and Hindu dharma-based news updates

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“The district collector said that fertilizer compost centers should be established in Nagireddipet, Kamareddy.” · confidence 90%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 80%Classification confidence: 87%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1973ms)

Processing trail
  1. NORMALIZED · 16 Sept, 14:33
  2. RELEVANCE_ACCEPTED · 16 Sept, 14:36
  3. ENRICHED · 16 Sept, 14:43
  4. DEDUPED · 16 Sept, 14:44
  5. NARRATIVE_ASSIGNED · 16 Sept, 14:44
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:51
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention b8caa96b · raw item aed2e2ae · origin live

YouTubeAcnChannel “Jagtial” NewsMedia organisation94%5 Jun, 20:22 IST
Jagtial (99% conf.)Telugustance: neutral123 views · 3 likes · 0 comments

జగిత్యాల జిల్లా లో వానకాల పంటలకు విత్తనాలు, ఎరువులు కొరత లేకుండా చూడాలి, బిజెపి కిసాన్ మోర్చా

Original — Telugu

జగిత్యాల జిల్లా లో వానకాల పంటలకు విత్తనాలు, ఎరువులు కొరత లేకుండా చూడాలి, బిజెపి కిసాన్ మోర్చా

Show full source text as published

జగిత్యాల జిల్లా లో వానకాల పంటలకు విత్తనాలు, ఎరువులు కొరత లేకుండా చూడాలి, బిజెపి కిసాన్ మోర్చా #AcnChannel #DailyNewsUpdates #Jagtial #acnchannel.com https://www.youtube.com/channel/UCiMHf3xEon8KadNzUjxfTXQ/join

English · AI translation

There should be no shortage of seeds and fertilizers for kharif crops in Jagtial district, says BJP Kisan Morcha.

seedsfertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“There should be no shortage of seeds and fertilizers for kharif crops in Jagtial district.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1955ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention a7bcc912 · raw item 48315574 · origin live

YouTubesiti popular channelMedia organisation94%3 Jun, 20:49 IST
Jagtial (99% conf.)Telugustance: neutral53 views · 4 likes · 0 comments

జగిత్యాల జిల్లా కేంద్రంలోని ఎరువులు , విత్తనాల షాపులలో పోలీసులు , వ్యవసాయ అధికారుల తనిఖీలు

Original — Telugu

#POPULARCHANNELJAGTIAL | NEWS 03.06.2020

English · AI translation

Police and agriculture officials conducted inspections at fertilizer and seed shops in Jagtial district headquarters. #POPULARCHANNELJAGTIAL | NEWS 03.06.2020

fertilizer-availabilityseeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Police and agriculture officials inspected fertilizer and seed shops in Jagtial district headquarters.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2301ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention e0f0e0d6 · raw item 1375a542 · origin live

YouTubeETV JaikisanMedia organisation99%24 Jan, 19:25 IST
Jangaon (97% conf.)Telugustance: neutral1,024 views · 26 likes · 1 comments

Jaikisan TS | 24th Jan '20 | సహజ ఎరువుల తయారీతో నాణ్యమైన దిగుబడులు సాధిస్తున్న జనగామ రైతు

Original — Telugu

వ్యవసాయంలో అధిక దిగుబడులను సాధించాలనే ఉద్దేశ్యంతో.... రైతులు పంటపొలాల్లో విచక్షణా రహితంగా రసాయన ఎరువులను వినియోగిస్తున్నారు. పురుగులు, తెగుళ్లు అంటూ నానా రకాల మందులు చల్లడం వల్ల పంట భూములు నిర్జీవంగా మారుతున్నాయి. ఫలితంగా నేలలో పంటకు బలాన్ని చేకూర్చే సూక్ష్మరాశి నశించి పంటలు మరింత బలహీనంగా మారుతున్నాయి. అలాగే పంట దిగుబడులు క్షీణిస్తున్నాయి. అయితే కృత్రిమ ఎరువులతో చేసే వ్యవసాయం కన్నా... ప్రకృతి సిద్ధంగా తయారు చేసిన ఎరువులతో భూసారాన్ని సంరక్షిచటంతో పాటు అధిక దిగుబడులు సాధించవచ్చని చెబుతున్నాడు జనగామ జిల్లాకు చెందిన రైతు వెంకన్న. తనకున్న 12 ఎకరాల భూమిలో సేంద్రియ, జీవ ఎరువులను ఉపయోగిస్తూ మేలైన లాభాలు సొంతం చేసుకుంటున్నాడు.

Show full source text as published

Jaikisan TS | 24th Jan '20 | సహజ ఎరువుల తయారీతో నాణ్యమైన దిగుబడులు సాధిస్తున్న జనగామ రైతు వ్యవసాయంలో అధిక దిగుబడులను సాధించాలనే ఉద్దేశ్యంతో.... రైతులు పంటపొలాల్లో విచక్షణా రహితంగా రసాయన ఎరువులను వినియోగిస్తున్నారు. పురుగులు, తెగుళ్లు అంటూ నానా రకాల మందులు చల్లడం వల్ల పంట భూములు నిర్జీవంగా మారుతున్నాయి. ఫలితంగా నేలలో పంటకు బలాన్ని చేకూర్చే సూక్ష్మరాశి నశించి పంటలు మరింత బలహీనంగా మారుతున్నాయి. అలాగే పంట దిగుబడులు క్షీణిస్తున్నాయి. అయితే కృత్రిమ ఎరువులతో చేసే వ్యవసాయం కన్నా... ప్రకృతి సిద్ధంగా తయారు చేసిన ఎరువులతో భూసారాన్ని సంరక్షిచటంతో పాటు అధిక దిగుబడులు సాధించవచ్చని చెబుతున్నాడు జనగామ జిల్లాకు చెందిన రైతు వెంకన్న. తనకున్న 12 ఎకరాల భూమిలో సేంద్రియ, జీవ ఎరువులను ఉపయోగిస్తూ మేలైన లాభాలు సొంతం చేసుకుంటున్నాడు. ---------------------------------------------------------------------------------------------- For Latest Updates on ETV Channels !! ☛ Visit our Official Website: http://www.etv.co.in ☛ Subscribe to Latest News - https://goo.gl/IdOFqr ☛ Subscribe to our YouTube Channel - http://bit.ly/29G9jkE Enjoy and stay connected with us !! ☛ Like us : https://www.facebook.com/etvjaikisan ☛ Follow us : https://twitter.com/etvjaikisan ☛ Circle us : https://goo.gl/1ySn5s ----------------------------------------------------------------------------------------------

English · AI translation

Jaikisan TS | 24th Jan '20 | A farmer from Jangaon achieves quality yields through the preparation of natural fertilizers With the aim of achieving higher yields in agriculture, farmers are indiscriminately using chemical fertilizers in crop fields. Spraying various medicines against pests and diseases is making the crop lands lifeless. As a result, the micronutrients in the soil that help strengthen the crop are getting destroyed, and the crops are becoming weaker. Crop yields are also declining. However, Jangaon district farmer Venkanna says that, instead of farming with artificial fertilizers, one can conserve soil fertility and achieve higher yields by using naturally prepared fertilizers. He is getting good profits by using organic and bio fertilizers on his 12 acres of land.

input-costfertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A farmer from Jangaon district uses natural and organic fertilizers on his 12 acres and says this helps him obtain better yields and profits.” · confidence 91%

Sentiment: neutralStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 100%Classification confidence: 94%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 3078ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:48
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  9. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  10. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 4e6f700c · raw item 1d78655f · origin live

YouTubeOm Vishwakarma Tv NewsMedia organisation86%28 Jun, 10:21 IST
Jagtial · Mallapur (99% conf.)Telugustance: neutral88 views · 2 likes · 1 comments

జగిత్యాల జిల్లా మల్లాపూర్ మొగిలిపేట్ గ్రామాలలో విత్తన ఎరువుల దుకాణాల తనిఖీ

Original — Telugu

జగిత్యాల జిల్లా మల్లాపూర్ మండల్ కలెక్టర్ ఆదేశాల మేరకు మల్లాపూర్ మొగిలిపేట్ గ్రామాలలో విత్తన ఎరువుల దుకాణాలను అకస్మాత్తుగా తనిఖీ చేసిన అధికారులు

English · AI translation

Inspection of seed and fertilizer shops in Mallapur and Mogilipet villages of Jagtial district. Acting on the Collector's orders, officials suddenly inspected seed and fertilizer shops in Mallapur and Mogilipet villages in Mallapur mandal, Jagtial district.

seedsfertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Officials conducted a sudden inspection of seed and fertilizer shops in Mallapur and Mogilipet villages of Jagtial district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 98%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2192ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  7. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  8. NARRATIVE_ASSIGNED · 17 Sept, 11:04
  9. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  10. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  11. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  12. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  13. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 9a21d07d · raw item 44dc91f5 · origin live

YouTubeAcnChannel “Jagtial” NewsMedia organisation94%22 May, 19:18 IST
Jagtial (98% conf.)Telugustance: neutral654 views · 8 likes · 0 comments

జగిత్యాల : పట్టణంలోని ఎరువుల దుకాణాల్లో పోలీస్, వ్యవసాయ అధికారుల తనిఖీలు

Original — Telugu

జగిత్యాల : పట్టణంలోని ఎరువుల దుకాణాల్లో పోలీస్, వ్యవసాయ అధికారుల తనిఖీలు

English · AI translation

Jagtial: Police and agriculture officials are inspecting fertilizer shops in the town.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Police and agriculture officials inspected fertilizer shops in Jagtial town.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 99%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1942ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:39
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 6bdb57ca · raw item 47c9c5f5 · origin live

YouTubeETV JaikisanMedia organisation99%28 Jul, 19:23 IST
Jagtial (95% conf.)Telugustance: neutral310 views · 3 likes · 0 comments

Jaikisan TS | 28th July '18 | ఎరువుల దొరక్క జగిత్యాల రైతుల గగ్గోలు

Original — Telugu

ఏడు రోజుల పాటు జరిగిన అఖిల భారత లారీ యజమానుల సమ్మె ముగిసింది. లారీలు రోడ్డెక్కాయి. కానీ ఈ ఏడు రోజుల పాటు రైతులు నానా పాట్లు పడ్డారు. అసలే ఖరీఫ్‌ కాలం కావడంతో సాగుకు ఎరువుల అవసరమైన సమయంలో సమ్మె కారణంగా ఎరువుల కొరత ఏర్పడింది.. డీలర్ల దగ్గర ఎరువులు లేకపోవడంతో.. ఏ ం చేయాలో తోచక రైతులు సతమతమయ్యారు. ప్రస్తుతం సమ్మె ముగిసినా ఎరువులు లభ్యం కావడానికి ఇంకా కొన్నిరోజులు పట్టే పరిస్థితి ఉందని డీలర్లు చెబుతున్నారు.

Show full source text as published

Jaikisan TS | 28th July '18 | ఎరువుల దొరక్క జగిత్యాల రైతుల గగ్గోలు ఏడు రోజుల పాటు జరిగిన అఖిల భారత లారీ యజమానుల సమ్మె ముగిసింది. లారీలు రోడ్డెక్కాయి. కానీ ఈ ఏడు రోజుల పాటు రైతులు నానా పాట్లు పడ్డారు. అసలే ఖరీఫ్‌ కాలం కావడంతో సాగుకు ఎరువుల అవసరమైన సమయంలో సమ్మె కారణంగా ఎరువుల కొరత ఏర్పడింది.. డీలర్ల దగ్గర ఎరువులు లేకపోవడంతో.. ఏ ం చేయాలో తోచక రైతులు సతమతమయ్యారు. ప్రస్తుతం సమ్మె ముగిసినా ఎరువులు లభ్యం కావడానికి ఇంకా కొన్నిరోజులు పట్టే పరిస్థితి ఉందని డీలర్లు చెబుతున్నారు. ---------------------------------------------------------------------------------------------- For Latest Updates on ETV Channels !! ☛ Visit our Official Website: http://www.etv.co.in ☛ Subscribe to Latest News - https://goo.gl/IdOFqr ☛ Subscribe to our YouTube Channel - http://bit.ly/29G9jkE Enjoy and stay connected with us !! ☛ Like us : https://www.facebook.com/etvjaikisan ☛ Follow us : https://twitter.com/etvjaikisan ☛ Circle us : https://goo.gl/1ySn5s ----------------------------------------------------------------------------------------------

English · AI translation

Jaikisan TS | 28th July '18 | Farmers in Jagtial are distressed because fertilizers are not available The seven-day all-India lorry owners' strike has ended. The lorries are back on the roads. But during these seven days, farmers suffered a lot. Since it was the kharif season and fertilizers were needed for cultivation, the strike caused a shortage of fertilizers. As there were no fertilizers with the dealers, farmers were troubled, not knowing what to do. Although the strike has now ended, dealers say it will still take a few more days for fertilizers to become available.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“A seven-day all-India truckers' strike caused a fertilizer shortage for farmers in Jagtial.” · confidence 93%

Sentiment: negativeStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 98%Classification confidence: 95%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2804ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:41
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 2c9b1c5a · raw item 6bb7fd09 · origin live

YouTubeOm Vishwakarma Tv NewsMedia organisation86%14 Jul, 18:47 IST
Mahabubabad · thorrur (98% conf.)Telugustance: neutral16 views · 0 likes · 0 comments

మహబూబాబాద్ జిల్లా : తొర్రుర్ డివిజన్ కేంద్రం లో కల్తీ విత్తనాలు ఎరువుల విక్రయాల పై అవగాహన సదస్సు

Original — Telugu

మహబూబాబాద్ జిల్లా : తొర్రుర్ డివిజన్ కేంద్రం లో కల్తీ విత్తనాలు ఎరువుల విక్రయాల పై అవగాహన సదస్సు

Show full source text as published

మహబూబాబాద్ జిల్లా : తొర్రుర్ డివిజన్ కేంద్రం లో కల్తీ విత్తనాలు ఎరువుల విక్రయాల పై అవగాహన సదస్సు మహబూబాబాద్ జిల్లా : తొర్రుర్ డివిజన్ కేంద్రం లో కల్తీ విత్తనాలు ఎరువుల విక్రయాల పై అవగాహన సదస్సు

English · AI translation

Mahabubabad district: An awareness seminar on fake seeds and fertilizer sales was held at the Thorrur division headquarters.

seedsfertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“An awareness seminar on fake seeds and fertilizer sales was held at the Thorrur division headquarters in Mahabubabad district.” · confidence 97%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 95%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2041ms)

Processing trail
  1. NORMALIZED · 17 Sept, 05:33
  2. RELEVANCE_ACCEPTED · 17 Sept, 05:36
  3. ENRICHED · 17 Sept, 05:43
  4. DEDUPED · 17 Sept, 05:45
  5. NARRATIVE_ASSIGNED · 17 Sept, 05:45
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention cd107171 · raw item dafc5ea2 · origin live

YouTubeDurga Siti CableMedia organisation97%29 Dec, 22:56 IST
Jagtial (96% conf.)Englishstance: neutral59 views · 0 likes · 0 comments

Bio Fertilizers Making Started at “Muncipal Park”| DSC | Jagtial |29.12.17

Original — English

Bio Fertilizers Making Started at “Muncipal Park”Bio Fertilizers Making Started at “Muncipal Park”| Durga Siti Cable | News |29.12.17 * Watch Durga Siti Cable News Everyday at 9.30pm & 8.00am * Social Media Finds New Role as News and Entertainment Curator

Show full source text as published

Bio Fertilizers Making Started at “Muncipal Park”| DSC | Jagtial |29.12.17 Bio Fertilizers Making Started at “Muncipal Park”Bio Fertilizers Making Started at “Muncipal Park”| Durga Siti Cable | News |29.12.17 * Watch Durga Siti Cable News Everyday at 9.30pm & 8.00am * Social Media Finds New Role as News and Entertainment Curator Watch #Live: http://www.durgasiticable.in/ Subscribe our YouTube Channel ► https://www.youtube.com/c/durgasiticable Visit our Website ►http://www.durgasiticable.in Facebook ►https://www.facebook.com/durgasiticable Twitter ► https://twitter.com/durgasiticable

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Bio fertilizers making started at Municipal Park in Jagtial on 29.12.17.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 80%Classification confidence: 93%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2484ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:28
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention fdfebc86 · raw item b024f811 · origin live

YouTubeDurga Siti CableMedia organisation97%23 Dec, 22:23 IST
Jagtial (97% conf.)Englishstance: neutral38 views · 0 likes · 0 comments

Awareness Camp on Fertilizers machines to dealers| DSC | Jagtial |23.12.17

Original — English

v| Durga Siti Cable | News |23.12.17 * Watch Durga Siti Cable News Everyday at 9.30pm & 8.00am * Social Media Finds New Role as News and Entertainment Curator

Show full source text as published

Awareness Camp on Fertilizers machines to dealers| DSC | Jagtial |23.12.17 v| Durga Siti Cable | News |23.12.17 * Watch Durga Siti Cable News Everyday at 9.30pm & 8.00am * Social Media Finds New Role as News and Entertainment Curator Watch #Live: http://www.durgasiticable.in/ Subscribe our YouTube Channel ► https://www.youtube.com/c/durgasiticable Visit our Website ►http://www.durgasiticable.in Facebook ►https://www.facebook.com/durgasiticable Twitter ► https://twitter.com/durgasiticable

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“An awareness camp on fertilizers and machines was held for dealers in Jagtial on 23.12.17.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 78%Classification confidence: 91%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2029ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:27
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  7. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  8. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  10. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  11. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  12. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  13. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 555519d8 · raw item 421fba24 · origin live

YouTubeMohammed IbrahimCitizen62%22 Nov, 13:27 IST
Jogulamba Gadwal (99% conf.)Telugustance: neutral1 views · 0 likes · 0 comments

జోగులాంబ గద్వాల జిల్లాలో కాలం చెల్లింన ఎరువులు పట్టివేత

Original — Telugu

జోగులాంబ గద్వాల జిల్లాలో కాలం చెల్లింన ఎరువులు పట్టివేత

English · AI translation

Expired fertilizers were seized in Jogulamba Gadwal district.

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Expired fertilizers were seized in Jogulamba Gadwal district.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 92%Classification confidence: 97%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1817ms)

Processing trail
  1. NORMALIZED · 16 Sept, 09:29
  2. RELEVANCE_ACCEPTED · 16 Sept, 09:33
  3. ENRICHED · 16 Sept, 09:38
  4. DEDUPED · 16 Sept, 09:41
  5. NARRATIVE_ASSIGNED · 16 Sept, 09:42
  6. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  7. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  8. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  9. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  10. NARRATIVE_ASSIGNED · 19 Sept, 02:50
  11. NARRATIVE_ASSIGNED · 19 Sept, 05:10

mention 9151c0f7 · raw item 0acb972e · origin live

YouTubeDurga Siti CableMedia organisation97%15 Jun, 21:59 IST
Jagtial (98% conf.)Telugustance: neutral167 views · 2 likes · 0 comments

Agriculture Dept Officials Raids On Fertilizer Shops In Jagtial | DSC | Jagtial |15.06.17

Original — Telugu

జిల్లా కేంద్రంలో ఎరువులు,విత్తనాల షాపులలో వ్యవసాయ శాఖ అధికారుల ఆకస్మిక తనిఖీలు | Durga Siti Cable | News |15.06.17 ఖరీఫ్ సీజన్ ప్రారంభమవుతున్న ప్రస్తుత పరిస్థితుల్లో నకిలీ విత్తనాలు , ఎరువులు అమ్ముతున్నారన్న సమాచారం మేరకు వ్యవసాయ శాఖ అధికారులు బుధవారం జిల్లా కేంద్రంలో ఆకస్మిక తనిఖీలు చేశారు.పట్టణంలోని ఓ రెండు దుకాణాలను తనిఖీ గావించారు.ఒక దుకాణంలో లైసెన్సు లేకుండా అమ్మకాలుగావిస్తున్నారాని సంబంధిత దుకాణాన్ని సీజ్ చేశారు.ఈ సందర్భంగా వ్యవసాయ శాఖ అధికారిణి ఉమారాణి మాట్లాడుతూ.ఖరీఫ్ సీజన్ దృష్ట్యా తనిఖీ లు చేపట్టడం జరిగిందనీ,అనుమతులు లేకుండా అమ్మకాలు చేస్తున్నందున , దుకాణాన్ని సీజ్ చేయడం జరిగిందని వివరించారు దుకాణంలో సుమారు రూ.18 లక్షల విలువ గల స్టాక్ ను సీజ్ చేయడం జరిగిందని వెల్లడించారు. * Watch Durga Siti Cable News Everyday at 9.30pm & 8.00am * Social Media Finds New Role as News and Entertainment Curator

Show full source text as published

Agriculture Dept Officials Raids On Fertilizer Shops In Jagtial | DSC | Jagtial |15.06.17 జిల్లా కేంద్రంలో ఎరువులు,విత్తనాల షాపులలో వ్యవసాయ శాఖ అధికారుల ఆకస్మిక తనిఖీలు | Durga Siti Cable | News |15.06.17 ****************************************** ఖరీఫ్ సీజన్ ప్రారంభమవుతున్న ప్రస్తుత పరిస్థితుల్లో నకిలీ విత్తనాలు , ఎరువులు అమ్ముతున్నారన్న సమాచారం మేరకు వ్యవసాయ శాఖ అధికారులు బుధవారం జిల్లా కేంద్రంలో ఆకస్మిక తనిఖీలు చేశారు.పట్టణంలోని ఓ రెండు దుకాణాలను తనిఖీ గావించారు.ఒక దుకాణంలో లైసెన్సు లేకుండా అమ్మకాలుగావిస్తున్నారాని సంబంధిత దుకాణాన్ని సీజ్ చేశారు.ఈ సందర్భంగా వ్యవసాయ శాఖ అధికారిణి ఉమారాణి మాట్లాడుతూ.ఖరీఫ్ సీజన్ దృష్ట్యా తనిఖీ లు చేపట్టడం జరిగిందనీ,అనుమతులు లేకుండా అమ్మకాలు చేస్తున్నందున , దుకాణాన్ని సీజ్ చేయడం జరిగిందని వివరించారు దుకాణంలో సుమారు రూ.18 లక్షల విలువ గల స్టాక్ ను సీజ్ చేయడం జరిగిందని వెల్లడించారు. * Watch Durga Siti Cable News Everyday at 9.30pm & 8.00am * Social Media Finds New Role as News and Entertainment Curator Watch #Live: http://www.durgasiticable.in/ Subscribe our YouTube Channel ► https://www.youtube.com/c/durgasiticable Visit our Website ►http://www.durgasiticable.in Facebook ►https://www.facebook.com/durgasiticable Twitter ► https://twitter.com/durgasiticable Script Source:http://www.telanganareporter.news/

English · AI translation

Agriculture Department officials' surprise inspections in fertilizer and seed shops in the district headquarters | Durga Siti Cable | News | 15.06.17 On the information that fake seeds and fertilizers were being sold in the current situation as the Kharif season is beginning, Agriculture Department officials conducted surprise inspections in the district headquarters on Wednesday. They inspected two shops in the town. In one shop, as sales were being conducted without a license, the concerned shop was sealed. On this occasion, Agriculture Department officer Umarani said that the inspections were conducted in view of the Kharif season, and that the shop was sealed because sales were being made without permissions. She stated that stock worth about Rs. 18 lakh in the shop was seized.

seedsfertilizer-availabilityfake-seeds
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“Agriculture department officials conducted surprise inspections of fertilizer and seed shops in Jagtial district headquarters and sealed one shop for selling without a license.” · confidence 96%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 99%Voice: third-party

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2161ms)

Processing trail
  1. NORMALIZED · 10 Sept, 01:26
  2. RELEVANCE_ACCEPTED · 10 Sept, 01:26
  3. ENRICHED · 10 Sept, 01:28
  4. DEDUPED · 10 Sept, 01:29
  5. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  6. NARRATIVE_ASSIGNED · 10 Sept, 01:30
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  9. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  12. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  13. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  14. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  15. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  16. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  17. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  18. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  19. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 906f2a36 · raw item 64892b4f · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%13 Sept, 20:21 IST
District not evidencedEnglishstance: neutral26 views · 0 likes · 0 reposts · 0 comments
Original — English

FO Shri K Sridhar along with AGTs conducted Crop Seminar on effective use of Nano Fertilisers for sustainable agriculture, with Agriculture Dept officials, scientists & 200+ farmers.@Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @Dept_ofAgriTG https://t.co/bGyQAoiSg8

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“IFFCO Telangana conducted a crop seminar on the effective use of nano fertilisers for sustainable agriculture with Agriculture Department officials, scientists, and more than 200 farmers.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 80%Agriculture relevance: 95%Classification confidence: 91%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2421ms)

Processing trail
  1. NORMALIZED · 14 Sept, 12:48
  2. RELEVANCE_ACCEPTED · 14 Sept, 12:50
  3. ENRICHED · 14 Sept, 12:57
  4. DEDUPED · 14 Sept, 12:58
  5. NARRATIVE_ASSIGNED · 14 Sept, 12:59
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention f2075864 · raw item 3b8f73f1 · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%13 Sept, 20:07 IST
District not evidencedEnglishstance: neutral31 views · 0 likes · 0 reposts · 0 comments
Original — English

AFM Shri Vishal organised Crop Seminar on INM at Anantharam along with Dept of Agriculture. The session highlighted Nano Fertilisers for enhanced nutrient use efficiency,soil health & sustainable crop productivity.

Show full source text as published

AFM Shri Vishal organised Crop Seminar on INM at Anantharam along with Dept of Agriculture. The session highlighted Nano Fertilisers for enhanced nutrient use efficiency,soil health & sustainable crop productivity. @Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @Dept_ofAgriTG https://t.co/2BY1XBllsE

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“AFM Shri Vishal organised a crop seminar on INM at Anantharam with the Department of Agriculture.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 86%Agriculture relevance: 98%Classification confidence: 86%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1822ms)

Processing trail
  1. NORMALIZED · 14 Sept, 12:48
  2. RELEVANCE_ACCEPTED · 14 Sept, 12:50
  3. ENRICHED · 14 Sept, 12:57
  4. DEDUPED · 14 Sept, 12:58
  5. NARRATIVE_ASSIGNED · 14 Sept, 12:59
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 279d7515 · raw item 8c9b6b05 · origin live

XGujarat State Fertilizers & Chemicals Ltd.@GSFCIndiaGovernment82%4 Sept, 18:00 IST
Warangal · Venkatpur (88% conf.)Englishstance: neutral56 views · 1 likes · 0 reposts · 0 comments
Original — English

As part of the PM-PRANAM Kisan Sangoshthi, GSFC reached 38 farmers at Venkatpur, Warangal district (Telangana), building awareness on: @BharatUrvarak #BalancedUseOfFertilizers #संतुलितउर्वरक #संतुलितखाद

Show full source text as published

🌱 उर्वरक की पाठशाला — संतुलित खाद अपनाएं, धरती मां को बचाएं As part of the PM-PRANAM Kisan Sangoshthi, GSFC reached 38 farmers at Venkatpur, Warangal district (Telangana), building awareness on: 🔹 Nutrient management — the 17 essential nutrients for crop growth and how to address deficiencies 🔹 Organic farming — the role of organic carbon in soil and the benefits of organic manure for soil health & productivity 🔹 Balanced fertilizer use — maintaining the ideal NPK ratio for healthy soil and good yields 📅 31st August 2026 | 📍 Venkatpur, Warangal, Telangana @BharatUrvarak #BalancedUseOfFertilizers #संतुलितउर्वरक #संतुलितखाद #GSFC #PMPRANAM #KisanSangoshthi #FarmersFirst

fertilizer-availabilityfarmer-support-schemes
Open original source ↗
AI interpretation & provenance
Extracted claim

“GSFC reached 38 farmers at Venkatpur in Warangal district, Telangana, as part of the PM-PRANAM Kisan Sangoshthi.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 80%Classification confidence: 91%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2248ms)

Processing trail
  1. NORMALIZED · 5 Sept, 03:20
  2. RELEVANCE_ACCEPTED · 5 Sept, 03:22
  3. ENRICHMENT_FAILED · 5 Sept, 03:44
  4. ENRICHMENT_FAILED · 5 Sept, 06:40
  5. ENRICHMENT_FAILED · 5 Sept, 08:10
  6. ENRICHED · 5 Sept, 09:39
  7. DEDUPED · 5 Sept, 09:40
  8. DEDUPED · 5 Sept, 13:18
  9. DEDUPED · 5 Sept, 15:08
  10. DEDUPED · 5 Sept, 17:02
  11. DEDUPED · 5 Sept, 18:17
  12. DEDUPED · 6 Sept, 13:03
  13. DEDUPED · 6 Sept, 14:23
  14. DEDUPED · 6 Sept, 22:35
  15. DEDUPED · 7 Sept, 00:06
  16. DEDUPED · 7 Sept, 02:27
  17. DEDUPED · 7 Sept, 03:44
  18. DEDUPED · 7 Sept, 05:07
  19. DEDUPED · 7 Sept, 06:25
  20. DEDUPED · 7 Sept, 07:41
  21. DEDUPED · 7 Sept, 09:04
  22. DEDUPED · 7 Sept, 11:24
  23. DEDUPED · 7 Sept, 12:38
  24. DEDUPED · 7 Sept, 18:36
  25. DEDUPED · 7 Sept, 23:52
  26. DEDUPED · 8 Sept, 01:07
  27. ENRICHED · 8 Sept, 01:48
  28. DEDUPED · 8 Sept, 02:10
  29. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  30. NARRATIVE_ASSIGNED · 8 Sept, 02:17
  31. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  32. NARRATIVE_ASSIGNED · 14 Sept, 14:20
  33. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  34. NARRATIVE_ASSIGNED · 14 Sept, 16:46
  35. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  36. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  37. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  38. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  39. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  40. NARRATIVE_ASSIGNED · 15 Sept, 14:41
  41. NARRATIVE_ASSIGNED · 16 Sept, 00:04
  42. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  43. NARRATIVE_ASSIGNED · 17 Sept, 03:11
  44. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  45. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  46. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  47. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  48. NARRATIVE_ASSIGNED · 23 Sept, 02:43
  49. NARRATIVE_ASSIGNED · 23 Sept, 13:03

mention 124cf029 · raw item 99b04072 · origin live

Near-duplicateXGujarat State Fertilizers & Chemicals Ltd.4 Sept, 21:00 ISTnot counted toward volume
YouTubeAgriculture Department Telangana Government99%3 Sept, 09:55 IST
District not evidencedTelugustance: neutral28,262 views · 148 likes · 12 comments

FFS ద్వారా ఎరువుల బుకింగ్ | 6 సులభమైన స్టెప్ లు | Fertilizer Booking | వ్యవసాయ శాఖ, తెలంగాణ

Original — Telugu

ప్రభుత్వ పథకాల సమాచారం, పంటల సలహాలు, వాతావరణ హెచ్చరికలు, మార్కెట్ ధరలు మరియు రైతులకు అవసరమైన అనేక ముఖ్యమైన విషయాలను సమయానికి అందించడమే మా లక్ష్యం. సహజ వ్యవసాయం, సేంద్రీయ వ్యవసాయం, పంటల సంరక్షణ, ఎరువుల వినియోగం, రైతు సంక్షేమ పథకాలు మరియు వ్యవసాయ సాంకేతికతపై తాజా వీడియోలను వీక్షించండి. తెలంగాణ రైతుల ఉత్పాదకతను పెంచి, ఆదాయాన్ని వృద్ధి చేయడానికి మా శాఖ కట్టుబడి ఉంది.

Show full source text as published

FFS ద్వారా ఎరువుల బుకింగ్ | 6 సులభమైన స్టెప్ లు | Fertilizer Booking | వ్యవసాయ శాఖ, తెలంగాణ 🌾 తెలంగాణ వ్యవసాయ శాఖ అధికారిక యూట్యూబ్ ఛానల్‌కు స్వాగతం ప్రభుత్వ పథకాల సమాచారం, పంటల సలహాలు, వాతావరణ హెచ్చరికలు, మార్కెట్ ధరలు మరియు రైతులకు అవసరమైన అనేక ముఖ్యమైన విషయాలను సమయానికి అందించడమే మా లక్ష్యం. సహజ వ్యవసాయం, సేంద్రీయ వ్యవసాయం, పంటల సంరక్షణ, ఎరువుల వినియోగం, రైతు సంక్షేమ పథకాలు మరియు వ్యవసాయ సాంకేతికతపై తాజా వీడియోలను వీక్షించండి. తెలంగాణ రైతుల ఉత్పాదకతను పెంచి, ఆదాయాన్ని వృద్ధి చేయడానికి మా శాఖ కట్టుబడి ఉంది. 🔔 తాజా అప్డేట్స్ కోసం మా ఛానల్‌ను Subscribe చేయండి. 🔗 YouTube Channel: https://www.youtube.com/@AgricultureDepartmentTelangana 🔗 X (Twitter) అధికారిక ఖాతా: https://x.com/DirectorAgriTS 📱 WhatsApp ఛానల్: https://whatsapp.com/channel/0029Vb61tsc59PwZEKYH3A0A #తెలంగాణవ్యవసాయం #రైతుసేవ #సహజవ్యవసాయం #ప్రభుత్వపథకాలు #తెలంగాణరైతులు #CropAdvisory #RythuBharosa #WeatherAlerts

English · AI translation

Fertilizer booking through FFS | 6 easy steps | Fertilizer Booking | Agriculture Department, Telangana Our goal is to timely provide information on government schemes, crop advice, weather alerts, market prices, and many important matters needed by farmers. Watch the latest videos on natural farming, organic farming, crop protection, fertilizer use, farmer welfare schemes, and agricultural technology. Our department is committed to increasing the productivity of Telangana farmers and improving their income. Greetings to farmer brothers. You all know that the fertilizer booking app introduced by the Telangana state government has been successfully implemented. Taking it as a model, the central government has brought out a mobile app called Framework for Fertilizer Sales (FFS) in a similar framework. This mobile app introduced by the central government called Framework for Fertilizer Sales is being implemented across the country in phases. Currently, in place of the fertilizer booking app being implemented by the Telangana government, this app will be implemented in all districts of Telangana in phases by the end of this August. Through this app, all kinds of fertilizers—urea, DAP, MOP, SSP, complex fertilizers—can be booked. In this video, I will explain how to book fertilizers in just six steps using this app. First step: installing the app from Google Play Store. Second step: logging in. Third step: entering land and crop details. Fourth step: selecting fertilizer quantity. Fifth step: selecting the retailer. Sixth step: generating the QR code. First step: installing the app. First, I am going to Google Play Store. I am typing Framework for Fertilizer Sales in the search box here. I am installing the app called Framework for Fertilizer Sales that appears here. After this app is installed, I am clicking the Open button. The first step of installing the app is completed. Now the second step, logging in. After opening the app, four easy steps on how to use the app are shown here. After reading all of them, I am changing the language to Telugu. I am clicking the Continue button. The login page opened. On this login page, three types of farmers have been provided the facility to log in. First type: farmers who have a pattadar passbook, Aadhaar, and a farmer ID. Second type: farmers who have a pattadar passbook and Aadhaar card but do not have a farmer ID. NDS means non-digitally signed farmers; they fall under this. Third type: farmers who do not have either pattadar passbook or farmer ID, but have only Aadhaar. These are included here. All three types of farmers can log in through this app. First I will show how the first type, that is, farmers who have pattadar passbook, Aadhaar, and farmer ID, can log in. To avoid confusion, I will explain the login methods for the second and third types of farmers at the end of the video. Except for this login method, the rest of the process is the same for all three types of farmers. Now in the state selection I am choosing Telangana. Here farmers can log in in two ways. First method: through Aadhaar number. Second method: through farmer ID. They can log in by either of these methods. First I will show the Aadhaar login method. After entering the Aadhaar number, when I tick the declaration checkbox, the declaration details appear. After reading all these details, I am clicking the Submit button. After the declaration is completed, authentication can be done in two ways. First is by entering OTP, or second is face authorisation. I am showing the OTP method first. Here I am clicking the Send OTP button. I am entering the OTP received on the mobile number linked to Aadhaar. Then I am clicking the button to verify identity. Now the fertilizer dashboard opened. We have learned about the first method, OTP. Now I will show how to do face authorisation in the second method. After entering the Aadhaar number, selecting face authorisation, and selecting the declaration checkbox, when the verify identity button is clicked, this box appears. In this, I am selecting Aadhaar Face RD. Then the screen appears like this. The front camera on the mobile has turned on; the farmer’s face should be kept inside the circle and the eyes should be blinked open and closed. This completes the process. So far we saw login for the first type of farmer through Aadhaar number. Now the same farmer can also log in through the farmer ID using the second method. By clicking the farmer ID option of the second method, just like Aadhaar login, here too the farmer ID can be entered and the remaining details can be entered in the same way to log in. So far we learned the full details about the second step, logging in. Now let us learn the third step, entering land and crop details. Note that the entire method I am about to explain is the same for all three types of farmers mentioned above. On this fertilizer dashboard page, a menu bar appears at the bottom. Four menus are visible in this menu bar. The first is the Home menu, where the dashboard is shown. The second is the My Farm menu, where land and survey number extent details are shown. The third is the History menu, where farmers can see all the details after booking and purchasing fertilizers. The fourth is the Profile menu, where farmer details are shown. By clicking the app language, the farmer can also change to the desired language from here. With the Help and Support option, the farmer’s doubts can be clarified. By clicking Logout, one can exit the app. Now let us go to the dashboard home page. Here the total land extent in the village is shown survey-number-wise. I am selecting the My Farm menu to choose land details and crop details. In this, the farmer’s name and land details appear automatically. If all land details related to the farmer are not visible, the Sync Lands with Farmer Registry button should be clicked. After clicking this, all land details related to the farmer will appear here. If any land details are not visible, the Add New Land button should be clicked. A title called Verified Lands appears. In this, click the box that says select the land to receive fertilizers and select the survey number. The land details related to that survey number appear below in a box. Also, in this search box that says search plots, you can type the survey number and get the survey number details here. In the box where land details are shown, click the checkbox near the option called Crops and select the crop. The page to select a crop opened. When the option to choose the crop category is clicked, 16 crop categories appear. By choosing the cereals category, one can select crops like paddy and maize. By choosing the fiber crops category, one can select cotton. By choosing the pulses category, one can select pulse crops like red gram, green gram, and black gram. By choosing the plantation crops other than fruits and vegetables category, one can select oil palm. By choosing the annual vegetables category, one can select vegetable crops. Here, to make crop selection easier, crops can also be obtained by typing the crop name in the search box. In this way, all survey numbers should be selected with crops in the same manner. I am clicking the button to confirm the crop to be grown. Now I am clicking the Apply for Fertilizers button. This completes the third step, entering land and crop details. Now let us see the fourth step, selecting the quantity of fertilizers. After clicking the Apply for Fertilizers button, a new page called Recommendation opens. Here the GFR recommended quantity appears. GFR means General Fertilizer Recommendation. According to this, based on the crop sown by the farmer and the land extent, the quantities of urea, DAP, complex, MOP and other fertilizers are suggested according to the General Fertilizer Recommendation. If the farmer wants to change the quantity of fertilizers according to their need, they should click the button to edit product quantities and go to the page to add fertilizers. At the top here three items appear. First is quantity, selecting the fertilizer quantity; second is retailer, selecting the retailer; third is receiver, to the fertilizer shop...

fertilizer-availabilityseed-availabilitypaddymaizecottonred-gramgreen-grambengal-gramgroundnuthorticulture
Open original source ↗
AI interpretation & provenance
Extracted claim

“The app allows farmers in Telangana to book fertilizers in six steps, and the video says it will be implemented across all districts in Telangana by the end of August.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 95%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 11496ms)

Processing trail
  1. NORMALIZED · 8 Sept, 03:16
  2. RELEVANCE_ACCEPTED · 8 Sept, 03:22
  3. ENRICHED · 8 Sept, 03:28
  4. DEDUPED · 8 Sept, 03:32
  5. NARRATIVE_ASSIGNED · 8 Sept, 03:33
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  16. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  17. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 1b9a35ea · raw item 1ee4f46e · origin live

XDeputy Director of Agriculture/DPD ATMA Jagityal@MJSudhakar8Government98%31 Aug, 10:26 IST
Jagtial · Mallapur (99% conf.)Englishstance: neutral36 views · 0 likes · 0 reposts · 0 comments
Original — English

🌾 A Nano Urea field demonstration was conducted under ATMA at Regunta village, Mallapur Mandal, Jagtial District, Telangana Farmers were sensitised on the dosage, method and timing of Nano Urea for efficient nitrogen use, sustainable crop production. @atmaagri @DirectorAgriTS https://t.co/CQOxl3UykD

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“A Nano Urea field demonstration was conducted under ATMA at Regunta village, Mallapur Mandal, Jagtial District, Telangana.” · confidence 99%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 98%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1624ms)

Processing trail
  1. NORMALIZED · 31 Aug, 19:20
  2. RELEVANCE_ACCEPTED · 31 Aug, 19:26
  3. ENRICHED · 31 Aug, 19:26
  4. DEDUPED · 31 Aug, 19:27
  5. NARRATIVE_ASSIGNED · 31 Aug, 19:27
  6. ENRICHED · 8 Sept, 01:41
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  19. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  20. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention d4b7d01b · raw item f670331b · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%28 Aug, 17:36 IST
District not evidencedEnglishstance: neutral43 views · 1 likes · 1 reposts · 0 comments
Original — English

AFM Shri A Venkatesh, AGT Shri Vamshi organised soil health card distribution program at Atmakur explaining soil testing, balanced nutrient management, Nano Fertilizers & DharAmruth. Around 75 farmers participated. @Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @IFFCO_Coop https://t.co/GA85X8eGB5

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“A soil health card distribution program was organized at Atmakur and around 75 farmers participated.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 85%Agriculture relevance: 100%Classification confidence: 89%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2093ms)

Processing trail
  1. NORMALIZED · 29 Aug, 14:54
  2. RELEVANCE_ACCEPTED · 29 Aug, 14:54
  3. ENRICHED · 29 Aug, 15:06
  4. DEDUPED · 29 Aug, 15:13
  5. NARRATIVE_ASSIGNED · 29 Aug, 15:13
  6. ENRICHED · 8 Sept, 01:30
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 6921d0c4 · raw item e5fe46dc · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%28 Aug, 17:27 IST
Jogulamba Gadwal (96% conf.)Englishstance: neutral40 views · 1 likes · 1 reposts · 0 comments
Original — English

Fo Shri K Raju in coordination with ICAR-CRIDA, organized one day Training Programme on Nano Fertilizers for Agriculture Dept officials at Jogulamba Gadwal. @Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @IFFCO_Coop @IcarCrida https://t.co/V5XyvVbmrc

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“A one-day training programme on nano fertilizers for Agriculture Department officials was organized at Jogulamba Gadwal in coordination with ICAR-CRIDA.” · confidence 95%

Sentiment: neutralStance toward government: neutralTelangana relevance: 82%Agriculture relevance: 98%Classification confidence: 92%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1576ms)

Processing trail
  1. NORMALIZED · 29 Aug, 14:53
  2. RELEVANCE_ACCEPTED · 29 Aug, 14:54
  3. ENRICHED · 29 Aug, 15:05
  4. DEDUPED · 29 Aug, 15:13
  5. NARRATIVE_ASSIGNED · 29 Aug, 15:13
  6. ENRICHED · 8 Sept, 01:30
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 5287ff41 · raw item 722760d2 · origin live

XCollector_Nagarkurnool@Collector_NGKLGovernment98%27 Aug, 22:00 IST
Nagarkurnool (99% conf.)Englishstance: supportive446 views · 5 likes · 0 reposts · 0 comments
Original — English

Nano Fertilizer Awareness The Collector urged officials to take modern agricultural technologies closer to farmers and ensure efficient, transparent delivery of services. @TelanganaCS @TelanganaCMO @IPRTelangana

Show full source text as published

Nano Fertilizer Awareness 🌱 Promote awareness on Nano Fertilizers among farmers: Nagarkurnool Collector Shri Hemanta Keshav Patil,IAS. ✔️ Educate farmers on Nano Urea & Nano DAP, benefits and scientific application ✔️ Strengthen Farmer Registration and effective use of the FFS App ✔️ Agriculture officials to conduct regular field visits and identify & resolve farmers’ issues ✔️ Ensure timely access to Rythu Bima benefits for eligible farmers The Collector urged officials to take modern agricultural technologies closer to farmers and ensure efficient, transparent delivery of services. @TelanganaCS @TelanganaCMO @IPRTelangana #Nagarkurnool #FarmerWelfare #NanoFertilizers #NanoUrea #NanoDAP #Agriculture #RythuBima #Telangana

fertilizer-availabilityfarm-mechanisation
Open original source ↗
AI interpretation & provenance
Extracted claim

“The Collector urged officials to take modern agricultural technologies closer to farmers and ensure efficient, transparent delivery of services.” · confidence 91%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 98%Agriculture relevance: 86%Classification confidence: 95%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2213ms)

Processing trail
  1. NORMALIZED · 29 Aug, 14:53
  2. RELEVANCE_ACCEPTED · 29 Aug, 14:54
  3. ENRICHED · 29 Aug, 15:08
  4. DEDUPED · 29 Aug, 15:13
  5. NARRATIVE_ASSIGNED · 29 Aug, 15:13
  6. ENRICHED · 8 Sept, 01:29
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 8 Sept, 02:20
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  19. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  20. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention dc23ac2f · raw item af90227b · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%25 Aug, 17:50 IST
District not evidencedEnglishstance: neutral54 views · 0 likes · 0 reposts · 0 comments
Original — English

Smt.Madhavilatha,IFFCO Chair Professor,PJTSAU interacted with 10,000 farmers through Rythu Nestham webinar across 1,600 Rythu Vedikas highlighting impact of excessive bulk fertilizer use & benefits of Nano Fertilizers.@Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @Dept_ofAgriTG https://t.co/6DtW80UvzN

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“Smt. Madhavilatha interacted with 10,000 farmers through a Rythu Nestham webinar across 1,600 Rythu Vedikas.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 85%Agriculture relevance: 95%Classification confidence: 92%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1846ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:30
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:44
  3. ENRICHED · 30 Aug, 01:37
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:26
  6. NARRATIVE_ASSIGNED · 30 Aug, 02:28
  7. ENRICHED · 8 Sept, 01:38
  8. DEDUPED · 8 Sept, 02:09
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  19. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  20. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 52f17aa7 · raw item ca845580 · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%25 Aug, 17:48 IST
District not evidencedEnglishstance: neutral203 views · 0 likes · 0 reposts · 0 comments
Original — English

FO Shri T. Balvikas participated in Rythu Nestham program, online webinar reaching around 10000 farmers through 1600 Rythu Vedikas. Farmer Shri M.Jangu shared his experience of using IFFCO Nano Fertilizers in cotton. @Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @Dept_ofAgriTG https://t.co/8QWV5doaeE

fertilizer-availabilitycotton
Open original source ↗
AI interpretation & provenance
Extracted claim

“FO Shri T. Balvikas participated in the Rythu Nestham program, an online webinar that reached around 10,000 farmers through 1,600 Rythu Vedikas.” · confidence 92%

Sentiment: neutralStance toward government: neutralTelangana relevance: 90%Agriculture relevance: 100%Classification confidence: 89%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1710ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:30
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:44
  3. ENRICHED · 30 Aug, 00:04
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:26
  6. NARRATIVE_ASSIGNED · 30 Aug, 02:27
  7. ENRICHED · 8 Sept, 01:32
  8. DEDUPED · 8 Sept, 02:09
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  19. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  20. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 97ace1d5 · raw item 824248cb · origin live

Near-duplicateXIFFCO Telangana1 Sept, 15:01 ISTnot counted toward volume
XIFFCO Telangana@IFFCO_TSGovernment84%25 Aug, 11:26 IST
District not evidencedEnglishstance: supportive80 views · 2 likes · 0 reposts · 0 comments
Original — English

Officials witnessed the production process & Nano DAP field demonstrations, gaining insights into sustainable agriculture & the role of cooperatives in promoting Nano Fertilizers.@Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @IFFCO_Coop @IffcoNanoBlr https://t.co/1GjhKVnHu7

fertilizer-availabilityfarm-mechanisation
Open original source ↗
AI interpretation & provenance
Extracted claim

“Officials witnessed the production process and Nano DAP field demonstrations.” · confidence 88%

Sentiment: positiveStance toward government: supportiveTelangana relevance: 60%Agriculture relevance: 90%Classification confidence: 78%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1467ms)

Processing trail
  1. NORMALIZED · 29 Aug, 14:53
  2. RELEVANCE_ACCEPTED · 29 Aug, 14:54
  3. ENRICHED · 29 Aug, 14:55
  4. DEDUPED · 29 Aug, 15:13
  5. DEDUPED · 29 Aug, 15:38
  6. DEDUPED · 29 Aug, 16:31
  7. DEDUPED · 30 Aug, 02:24
  8. DEDUPED · 30 Aug, 04:49
  9. DEDUPED · 30 Aug, 06:00
  10. DEDUPED · 30 Aug, 11:42
  11. DEDUPED · 30 Aug, 12:55
  12. DEDUPED · 30 Aug, 14:11
  13. DEDUPED · 30 Aug, 15:19
  14. DEDUPED · 30 Aug, 16:32
  15. DEDUPED · 30 Aug, 19:03
  16. DEDUPED · 30 Aug, 20:31
  17. DEDUPED · 30 Aug, 21:44
  18. DEDUPED · 30 Aug, 23:01
  19. DEDUPED · 31 Aug, 00:09
  20. DEDUPED · 31 Aug, 01:16
  21. DEDUPED · 31 Aug, 02:32
  22. DEDUPED · 31 Aug, 07:41
  23. DEDUPED · 31 Aug, 08:53
  24. DEDUPED · 31 Aug, 10:01
  25. DEDUPED · 31 Aug, 14:30
  26. DEDUPED · 31 Aug, 15:44
  27. DEDUPED · 31 Aug, 16:52
  28. DEDUPED · 31 Aug, 18:00
  29. DEDUPED · 31 Aug, 19:27
  30. DEDUPED · 31 Aug, 20:41
  31. DEDUPED · 31 Aug, 22:01
  32. DEDUPED · 31 Aug, 23:11
  33. DEDUPED · 1 Sept, 00:31
  34. DEDUPED · 1 Sept, 01:39
  35. DEDUPED · 1 Sept, 02:47
  36. DEDUPED · 1 Sept, 04:00
  37. DEDUPED · 1 Sept, 11:24
  38. DEDUPED · 1 Sept, 12:33
  39. DEDUPED · 1 Sept, 13:41
  40. DEDUPED · 1 Sept, 15:18
  41. DEDUPED · 1 Sept, 16:50
  42. DEDUPED · 1 Sept, 18:10
  43. DEDUPED · 1 Sept, 23:18
  44. DEDUPED · 2 Sept, 11:37
  45. DEDUPED · 2 Sept, 13:57
  46. DEDUPED · 2 Sept, 17:06
  47. DEDUPED · 2 Sept, 19:31
  48. DEDUPED · 2 Sept, 20:59
  49. DEDUPED · 2 Sept, 22:14
  50. DEDUPED · 3 Sept, 00:37
  51. DEDUPED · 3 Sept, 02:05
  52. DEDUPED · 3 Sept, 03:30
  53. DEDUPED · 3 Sept, 04:47
  54. DEDUPED · 3 Sept, 10:58
  55. DEDUPED · 3 Sept, 14:29
  56. DEDUPED · 3 Sept, 16:13
  57. DEDUPED · 3 Sept, 17:32
  58. DEDUPED · 3 Sept, 18:50
  59. DEDUPED · 3 Sept, 21:27
  60. DEDUPED · 4 Sept, 01:19
  61. DEDUPED · 4 Sept, 02:57
  62. DEDUPED · 4 Sept, 06:23
  63. DEDUPED · 4 Sept, 07:55
  64. DEDUPED · 4 Sept, 09:19
  65. DEDUPED · 4 Sept, 10:43
  66. DEDUPED · 4 Sept, 13:28
  67. DEDUPED · 4 Sept, 18:04
  68. DEDUPED · 4 Sept, 20:35
  69. DEDUPED · 4 Sept, 22:08
  70. DEDUPED · 4 Sept, 23:35
  71. DEDUPED · 5 Sept, 03:47
  72. DEDUPED · 5 Sept, 06:41
  73. DEDUPED · 5 Sept, 08:12
  74. DEDUPED · 5 Sept, 09:40
  75. DEDUPED · 5 Sept, 13:17
  76. DEDUPED · 5 Sept, 15:07
  77. DEDUPED · 5 Sept, 17:01
  78. DEDUPED · 5 Sept, 18:17
  79. DEDUPED · 6 Sept, 13:02
  80. DEDUPED · 6 Sept, 14:22
  81. DEDUPED · 6 Sept, 15:57
  82. DEDUPED · 6 Sept, 18:50
  83. DEDUPED · 6 Sept, 21:21
  84. DEDUPED · 6 Sept, 22:34
  85. DEDUPED · 7 Sept, 00:06
  86. DEDUPED · 7 Sept, 02:26
  87. DEDUPED · 7 Sept, 03:44
  88. DEDUPED · 7 Sept, 05:07
  89. DEDUPED · 7 Sept, 06:24
  90. DEDUPED · 7 Sept, 07:40
  91. DEDUPED · 7 Sept, 09:03
  92. DEDUPED · 7 Sept, 11:23
  93. DEDUPED · 7 Sept, 12:37
  94. DEDUPED · 7 Sept, 18:35
  95. DEDUPED · 7 Sept, 23:51
  96. DEDUPED · 8 Sept, 01:06
  97. ENRICHED · 8 Sept, 01:30
  98. DEDUPED · 8 Sept, 02:09
  99. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  100. NARRATIVE_ASSIGNED · 8 Sept, 02:20
  101. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  102. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  103. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  104. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  105. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  106. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  107. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  108. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  109. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  110. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  111. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  112. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention b96559c1 · raw item 61cfac08 · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%24 Aug, 18:19 IST
District not evidencedEnglishstance: neutral81 views · 0 likes · 0 reposts · 0 comments
Original — English

AFM Shri A Venkatesh organized Nano fertilizer awareness meeting with ATMA & Agriculture Depat officials focusing on INM, balanced Nano Fertilizer use for sustainable farming. Around 68 farmers & 6 AEOs participated.@Dileep_Sanghani @KiritkrJPatel @iffcoyogendra @Dept_ofAgriTG https://t.co/nthplA0EAT

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“AFM Shri A Venkatesh organized a Nano fertilizer awareness meeting with ATMA and Agriculture Department officials, and around 68 farmers and 6 AEOs participated.” · confidence 94%

Sentiment: neutralStance toward government: neutralTelangana relevance: 80%Agriculture relevance: 95%Classification confidence: 89%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1706ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:27
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:43
  3. ENRICHED · 29 Aug, 23:48
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:26
  6. ENRICHED · 8 Sept, 01:38
  7. DEDUPED · 8 Sept, 02:09
  8. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  9. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  10. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  11. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  13. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  14. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  15. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  16. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  17. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50

mention 44d5af53 · raw item 5edb05fb · origin live

XIFFCO Telangana@IFFCO_TSGovernment84%25 May, 10:33 IST
District not evidencedEnglishstance: neutral279 views · 3 likes · 3 reposts · 0 comments
Original — English

As part of PrajaPalana Pragathi Pranalika-99 Days Action Plan Program, A stall was set up showcasing Nano Urea,Nano DAP,Nano Zinc, Nano Copper & Bio Fertilizers where the importance & uses of these products in agricultural crops were explained to the chief dignitaries & farmers. https://t.co/kjaztiwwBO

fertilizer-availability
Open original source ↗
AI interpretation & provenance
Extracted claim

“A stall was set up showcasing Nano Urea, Nano DAP, Nano Zinc, Nano Copper, and bio fertilizers, and their importance and uses in agricultural crops were explained to dignitaries and farmers.” · confidence 93%

Sentiment: neutralStance toward government: neutralTelangana relevance: 70%Agriculture relevance: 95%Classification confidence: 88%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1544ms)

Processing trail
  1. NORMALIZED · 29 Aug, 17:22
  2. RELEVANCE_ACCEPTED · 29 Aug, 17:43
  3. ENRICHED · 30 Aug, 01:04
  4. DEDUPED · 30 Aug, 02:24
  5. NARRATIVE_ASSIGNED · 30 Aug, 02:25
  6. ENRICHED · 8 Sept, 01:36
  7. DEDUPED · 8 Sept, 02:08
  8. NARRATIVE_ASSIGNED · 8 Sept, 02:12
  9. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  10. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  11. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  12. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  13. NARRATIVE_ASSIGNED · 15 Sept, 05:22
  14. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  15. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  16. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  17. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  18. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  19. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  20. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 202512e2 · raw item e6786b71 · origin live

YouTubeICAR-IIORGovernment95%18 May, 15:11 IST
Siddipet · Narayanaraopet (98% conf.)Englishstance: neutral124 views · 0 likes · 0 comments

Farmer Feedback on Balanced Fertilizer Use | ICAR-IIOR | Gopulapur Village, Siddipet

Original — English

ICAR-IIOR organized an Intensive Program on Balanced Fertilizer Use at Gopulapur village, Narayanaraopet Mandal, Siddipet District on 18.05.2025. During the programme, farmers shared their feedback and experiences on balanced nutrient management practices, soil health improvement, and sustainable agriculture. ICAR-IIOR scientists interacted with farmers and created awareness on the importance of applying fertilizers in the right source, right dose, right time, and right method for improving crop productivity and maintaining soil fertility.

Show full source text as published

Farmer Feedback on Balanced Fertilizer Use | ICAR-IIOR | Gopulapur Village, Siddipet ICAR-IIOR organized an Intensive Program on Balanced Fertilizer Use at Gopulapur village, Narayanaraopet Mandal, Siddipet District on 18.05.2025. During the programme, farmers shared their feedback and experiences on balanced nutrient management practices, soil health improvement, and sustainable agriculture. ICAR-IIOR scientists interacted with farmers and created awareness on the importance of applying fertilizers in the right source, right dose, right time, and right method for improving crop productivity and maintaining soil fertility. 👨‍🌾 About 42 farmers participated in the awareness and feedback session. #ICAR #ICARIIOR #FarmerFeedback #BalancedFertilizerUse #SoilHealth #SustainableAgriculture #Farmers #Siddipet #Agriculture #NutrientManagement

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“ICAR-IIOR organized an Intensive Program on Balanced Fertilizer Use at Gopulapur village, Narayanaraopet Mandal, Siddipet District on 18.05.2025.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 96%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1406ms)

Processing trail
  1. NORMALIZED · 11 Sept, 04:15
  2. RELEVANCE_ACCEPTED · 11 Sept, 04:15
  3. ENRICHED · 11 Sept, 04:16
  4. DEDUPED · 11 Sept, 04:16
  5. NARRATIVE_ASSIGNED · 11 Sept, 04:17
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:36
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:19
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 50a5cb14 · raw item 669bbaee · origin live

Near-duplicateYouTubeICAR-IIOR19 May, 16:38 ISTnot counted toward volume

Farmer Feedback on Balanced Fertilizer Use Campaign | ICAR-IIOR | Kasturipalli Village

YouTubeICAR-IIORGovernment95%7 May, 10:35 IST
Siddipet · Chinnakodur (99% conf.)Englishstance: neutral77 views · 2 likes · 0 comments

Farmer feedback on Balanced Use of Fertilizers

Original — English

ICAR–Indian Institute of Oilseeds Research (ICAR-IIOR) organized an MGMG programme on Balanced Use of Fertilizers at Pedakodur village, Chinnakodur Mandal, Siddipet District on 06 May 2026. During the programme, farmers shared their valuable feedback and experiences on balanced nutrient management practices and their role in improving soil health, crop productivity, and sustainable agriculture. The interaction focused on: ICAR-IIOR continues to work closely with farmers through awareness programmes and field interactions to promote scientific and sustainable agricultural practices.

Show full source text as published

Farmer feedback on Balanced Use of Fertilizers ICAR–Indian Institute of Oilseeds Research (ICAR-IIOR) organized an MGMG programme on Balanced Use of Fertilizers at Pedakodur village, Chinnakodur Mandal, Siddipet District on 06 May 2026. During the programme, farmers shared their valuable feedback and experiences on balanced nutrient management practices and their role in improving soil health, crop productivity, and sustainable agriculture. The interaction focused on: ✅ Importance of balanced fertilizer application ✅ Soil health management ✅ Efficient nutrient use ✅ Sustainable farming practices ✅ Enhancing crop productivity ICAR-IIOR continues to work closely with farmers through awareness programmes and field interactions to promote scientific and sustainable agricultural practices. #ICAR #ICAR_IIOR #BalancedFertilizerUse #FarmerFeedback #SustainableAgriculture #SoilHealth #NutrientManagement #MGMG #Agriculture #Farmers #Telangana #Siddipet

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“ICAR-IIOR organized an MGMG programme on balanced use of fertilizers at Pedakodur village, Chinnakodur Mandal, Siddipet District on 06 May 2026.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 94%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1595ms)

Processing trail
  1. NORMALIZED · 11 Sept, 04:15
  2. RELEVANCE_ACCEPTED · 11 Sept, 04:15
  3. ENRICHED · 11 Sept, 04:16
  4. DEDUPED · 11 Sept, 04:16
  5. NARRATIVE_ASSIGNED · 11 Sept, 04:17
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:04
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 657e7e12 · raw item 74f33d25 · origin live

YouTubeICAR-IIORGovernment95%5 May, 14:16 IST
Vikarabad · Pudur (99% conf.)Englishstance: neutral104 views · 2 likes · 0 comments

MGMG Farmers’ Interaction on Balanced Fertilizer Use | Manchapalle, Vikarabad | ICAR-IIOR

Original — English

ICAR–Indian Institute of Oilseeds Research (ICAR-IIOR) organized an MGMG Farmers’ Interaction Programme on balanced fertilizer use at Manchapalle Village, Pudur Mandal, Vikarabad District, Telangana. The programme emphasized: Farmers actively interacted with scientists and gained valuable insights on scientific fertilizer management practices for sustainable farming.

Show full source text as published

MGMG Farmers’ Interaction on Balanced Fertilizer Use | Manchapalle, Vikarabad | ICAR-IIOR ICAR–Indian Institute of Oilseeds Research (ICAR-IIOR) organized an MGMG Farmers’ Interaction Programme on balanced fertilizer use at Manchapalle Village, Pudur Mandal, Vikarabad District, Telangana. The programme emphasized: ✅ Balanced nutrient management ✅ Soil health improvement ✅ Sustainable agriculture practices ✅ Enhancing crop productivity Farmers actively interacted with scientists and gained valuable insights on scientific fertilizer management practices for sustainable farming. #ICARIIOR #BalancedFertilizerUse #SustainableFarming #FarmersInteraction #MGMG

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“ICAR-IIOR organized an MGMG Farmers’ Interaction Programme on balanced fertilizer use at Manchapalle Village, Pudur Mandal, Vikarabad District, Telangana.” · confidence 98%

Sentiment: neutralStance toward government: neutralTelangana relevance: 100%Agriculture relevance: 100%Classification confidence: 97%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 2179ms)

Processing trail
  1. NORMALIZED · 11 Sept, 11:18
  2. RELEVANCE_ACCEPTED · 11 Sept, 11:18
  3. ENRICHED · 11 Sept, 11:19
  4. DEDUPED · 11 Sept, 11:21
  5. NARRATIVE_ASSIGNED · 11 Sept, 11:21
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 05:46
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention 843e3526 · raw item 4f2ae673 · origin live

YouTubeICAR-IIORGovernment95%27 Apr, 17:17 IST
Siddipet (98% conf.)Englishstance: neutral10 views · 1 likes · 0 comments

Balanced Fertilizer Use Awareness Campaign at Ibrahimpur | ICAR-IIOR | Siddipet

Original — English

ICAR-IIOR organized an awareness campaign on the balanced use of fertilizers on 27/04/2026 at Ibrahimpur village, Siddipet district, Telangana. 🌱 The program focused on educating farmers about sustainable nutrient management practices to improve soil health and crop productivity. Scientists interacted with farmers and shared insights on the 4R principles (Right Source, Right Rate, Right Time, Right Place) and Integrated Nutrient Management (INM). Key highlights of the campaign: Farmers actively participated in the session and gained practical knowledge to adopt better farming practices.

Show full source text as published

Balanced Fertilizer Use Awareness Campaign at Ibrahimpur | ICAR-IIOR | Siddipet ICAR-IIOR organized an awareness campaign on the balanced use of fertilizers on 27/04/2026 at Ibrahimpur village, Siddipet district, Telangana. 🌱 The program focused on educating farmers about sustainable nutrient management practices to improve soil health and crop productivity. Scientists interacted with farmers and shared insights on the 4R principles (Right Source, Right Rate, Right Time, Right Place) and Integrated Nutrient Management (INM). Key highlights of the campaign: ✔ Importance of balanced fertilizer application ✔ Promoting soil testing and Soil Health Cards ✔ Reducing excessive use of urea and DAP ✔ Enhancing soil fertility and long-term sustainability Farmers actively participated in the session and gained practical knowledge to adopt better farming practices. 🌿 Towards Healthy Soil, Better Yield, and Sustainable Agriculture #ICAR #ICARIIOR #BalancedFertilizerUse #SoilHealth #SustainableFarming #Telangana

fertilizer-availability
Open original source ↗Transcript not available — analysed from title, description and metadata
AI interpretation & provenance
Extracted claim

“ICAR-IIOR organized an awareness campaign on the balanced use of fertilizers on 27/04/2026 at Ibrahimpur village, Siddipet district, Telangana.” · confidence 98%

Sentiment: positiveStance toward government: neutralTelangana relevance: 98%Agriculture relevance: 100%Classification confidence: 95%Voice: official

Enriched by openai/gpt-5.4-mini (prompt llm-v3, 1560ms)

Processing trail
  1. NORMALIZED · 11 Sept, 04:15
  2. RELEVANCE_ACCEPTED · 11 Sept, 04:15
  3. ENRICHED · 11 Sept, 04:16
  4. DEDUPED · 11 Sept, 04:16
  5. NARRATIVE_ASSIGNED · 11 Sept, 04:17
  6. NARRATIVE_ASSIGNED · 14 Sept, 14:03
  7. NARRATIVE_ASSIGNED · 14 Sept, 16:39
  8. NARRATIVE_ASSIGNED · 14 Sept, 22:26
  9. NARRATIVE_ASSIGNED · 15 Sept, 02:26
  10. NARRATIVE_ASSIGNED · 15 Sept, 05:23
  11. NARRATIVE_ASSIGNED · 15 Sept, 09:11
  12. NARRATIVE_ASSIGNED · 15 Sept, 14:37
  13. NARRATIVE_ASSIGNED · 16 Sept, 03:20
  14. NARRATIVE_ASSIGNED · 17 Sept, 20:58
  15. NARRATIVE_ASSIGNED · 18 Sept, 04:05
  16. NARRATIVE_ASSIGNED · 18 Sept, 23:50
  17. NARRATIVE_ASSIGNED · 19 Sept, 02:50

mention ddc467cb · raw item ed0747b9 · origin live